BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0497 (563 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56628| Best HMM Match : Actin (HMM E-Value=0) 120 8e-28 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 5e-26 SB_56| Best HMM Match : Actin (HMM E-Value=0) 114 5e-26 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 1e-25 SB_54| Best HMM Match : Actin (HMM E-Value=0) 72 4e-13 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 8e-11 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 64 1e-10 SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) 58 5e-09 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 50 2e-06 SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6) 47 9e-06 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 41 6e-04 SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) 40 0.001 SB_18097| Best HMM Match : NadA (HMM E-Value=2.2) 32 0.28 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_21074| Best HMM Match : NadA (HMM E-Value=2) 32 0.37 SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) 32 0.37 SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.37 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.49 SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8) 31 0.49 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 31 0.49 SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17) 30 1.5 SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) 30 1.5 SB_37416| Best HMM Match : ResIII (HMM E-Value=1.2) 29 2.0 SB_56842| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_28400| Best HMM Match : PMSR (HMM E-Value=1.7e-24) 28 4.6 SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 28 4.6 SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) 28 6.1 SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) 28 6.1 SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 28 6.1 SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) 28 6.1 SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) 28 6.1 SB_57561| Best HMM Match : fn3 (HMM E-Value=0) 27 8.0 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 27 8.0 SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 27 8.0 SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 27 8.0 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 27 8.0 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 27 8.0 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 27 8.0 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 27 8.0 SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 27 8.0 SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) 27 8.0 SB_53316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 27 8.0 SB_10020| Best HMM Match : Extensin_2 (HMM E-Value=0.88) 27 8.0 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 120 bits (289), Expect = 8e-28 Identities = 54/62 (87%), Positives = 59/62 (95%) Frame = +3 Query: 87 MCDEEVAALVVDNGSGMCKAGFAGEDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHR 266 MCD++VAALVVDNGSGMCKAGFAG+DAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG + Sbjct: 1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60 Query: 267 AK 272 +K Sbjct: 61 SK 62 Score = 105 bits (253), Expect = 2e-23 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 391 +EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH Sbjct: 57 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 102 Score = 82.6 bits (195), Expect = 2e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +1 Query: 379 PRGTPVLLTEXPLNPKANREKMTQXMFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFGD 558 P PVLLTE PLNPKANREKMTQ MFE FN+PAMYVAIQAVL S V+D GD Sbjct: 99 PEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD 158 Query: 559 G 561 G Sbjct: 159 G 159 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 116 bits (278), Expect = 2e-26 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = +3 Query: 87 MCDEEVAALVVDNGSGMCKAGFAGEDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHR 266 M D+E+AALVVDNGSGMCKAGFAG+DAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG + Sbjct: 1 MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60 Query: 267 AK 272 +K Sbjct: 61 SK 62 Score = 105 bits (253), Expect = 2e-23 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 391 +EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH Sbjct: 57 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 102 Score = 82.6 bits (195), Expect = 2e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +1 Query: 379 PRGTPVLLTEXPLNPKANREKMTQXMFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFGD 558 P PVLLTE PLNPKANREKMTQ MFE FN+PAMYVAIQAVL S V+D GD Sbjct: 99 PEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD 158 Query: 559 G 561 G Sbjct: 159 G 159 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 116 bits (278), Expect = 2e-26 Identities = 51/62 (82%), Positives = 58/62 (93%) Frame = +3 Query: 87 MCDEEVAALVVDNGSGMCKAGFAGEDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHR 266 M D+++AALV+DNGSGMCKAGFAG+DAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG + Sbjct: 1 MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60 Query: 267 AK 272 +K Sbjct: 61 SK 62 Score = 105 bits (253), Expect = 2e-23 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 391 +EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH Sbjct: 57 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 102 Score = 82.6 bits (195), Expect = 2e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +1 Query: 379 PRGTPVLLTEXPLNPKANREKMTQXMFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFGD 558 P PVLLTE PLNPKANREKMTQ MFE FN+PAMYVAIQAVL S V+D GD Sbjct: 99 PEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD 158 Query: 559 G 561 G Sbjct: 159 G 159 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 114 bits (274), Expect = 5e-26 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = +3 Query: 93 DEEVAALVVDNGSGMCKAGFAGEDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHRAK 272 D++VAALV+DNGSGMCKAGFAG+DAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG ++K Sbjct: 2 DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF 358 +EAQSKRGILTLKYPIEHGIVTNWDDMEKI TF Sbjct: 56 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIMFETF 90 Score = 46.0 bits (104), Expect = 2e-05 Identities = 24/44 (54%), Positives = 28/44 (63%) Frame = +1 Query: 430 NREKMTQXMFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFGDG 561 N + M + MFE FN+PAMYVAIQAVL S V+D GDG Sbjct: 78 NWDDMEKIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDG 121 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 114 bits (274), Expect = 5e-26 Identities = 52/60 (86%), Positives = 57/60 (95%) Frame = +3 Query: 93 DEEVAALVVDNGSGMCKAGFAGEDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHRAK 272 ++EVAALVVDNGSGMCKAGFAG+DAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG ++K Sbjct: 2 EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61 Score = 105 bits (253), Expect = 2e-23 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 391 +EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH Sbjct: 56 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 101 Score = 82.6 bits (195), Expect = 2e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +1 Query: 379 PRGTPVLLTEXPLNPKANREKMTQXMFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFGD 558 P PVLLTE PLNPKANREKMTQ MFE FN+PAMYVAIQAVL S V+D GD Sbjct: 98 PEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD 157 Query: 559 G 561 G Sbjct: 158 G 158 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 113 bits (271), Expect = 1e-25 Identities = 51/60 (85%), Positives = 57/60 (95%) Frame = +3 Query: 93 DEEVAALVVDNGSGMCKAGFAGEDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGMRHRAK 272 +++VAALVVDNGSGMCKAGFAG+DAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG ++K Sbjct: 2 EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61 Score = 105 bits (253), Expect = 2e-23 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 391 +EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH Sbjct: 56 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 101 Score = 82.6 bits (195), Expect = 2e-16 Identities = 42/61 (68%), Positives = 44/61 (72%) Frame = +1 Query: 379 PRGTPVLLTEXPLNPKANREKMTQXMFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFGD 558 P PVLLTE PLNPKANREKMTQ MFE FN+PAMYVAIQAVL S V+D GD Sbjct: 98 PEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD 157 Query: 559 G 561 G Sbjct: 158 G 158 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 71.7 bits (168), Expect = 4e-13 Identities = 35/57 (61%), Positives = 38/57 (66%) Frame = +1 Query: 391 PVLLTEXPLNPKANREKMTQXMFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFGDG 561 PVLLTE PLNPK NRE+M Q MFE FN P MYVA+QAV+ S V D GDG Sbjct: 2147 PVLLTEAPLNPKMNRERMVQLMFESFNVPCMYVAVQAVMALYASGRTTGTVFDCGDG 2203 Score = 58.0 bits (134), Expect = 5e-09 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = +3 Query: 111 LVVDNGSGMCKAGFAGEDAPRAVFPSIVGRPRHQ 212 +V+DNGSG CKAG + +++PR VFP+IVGRPRH+ Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 64.1 bits (149), Expect = 8e-11 Identities = 32/61 (52%), Positives = 38/61 (62%) Frame = +1 Query: 379 PRGTPVLLTEXPLNPKANREKMTQXMFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFGD 558 PR T VLLTE PLNP NREKM + MFE + +Y+AIQAVL + V+D GD Sbjct: 102 PRNTKVLLTEPPLNPMKNREKMIEVMFENYQFEGVYIAIQAVLTLYAQGLLTGVVIDSGD 161 Query: 559 G 561 G Sbjct: 162 G 162 Score = 48.8 bits (111), Expect = 3e-06 Identities = 20/50 (40%), Positives = 32/50 (64%) Frame = +2 Query: 209 SGRDGRYGTEGLLCRNEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF 358 S + G + L+ +EA R +L + YP+++GIV NWDDM+ +W +TF Sbjct: 44 SQKVGDIEVKDLMVGDEASQLRYMLEVNYPMDNGIVRNWDDMKHVWDYTF 93 Score = 44.4 bits (100), Expect = 7e-05 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +3 Query: 105 AALVVDNGSGMCKAGFAGEDAPRAVFPSIVGRP 203 + +V DNG+G K G+AG + P +FPS+VGRP Sbjct: 7 SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRP 39 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 63.7 bits (148), Expect = 1e-10 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = +1 Query: 391 PVLLTEXPLNPKANREKMTQXMFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFGDG 561 PVLLTE PLNP+ NREK + FE FN PA+++++QAVL + VLD GDG Sbjct: 128 PVLLTEAPLNPRRNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDAGDG 184 >SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) Length = 1392 Score = 58.0 bits (134), Expect = 5e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +3 Query: 96 EEVAALVVDNGSGMCKAGFAGEDAPRAVFPSIVGRPRHQ 212 E LV+D GS M K GFAG+DAP+ VFP IVGRPRHQ Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/49 (40%), Positives = 32/49 (65%) Frame = +3 Query: 81 FKMCDEEVAALVVDNGSGMCKAGFAGEDAPRAVFPSIVGRPRHQGVMVG 227 FK+ A+V+DNG G+ K GFAG+ PR + P++VG P+ +++G Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIG 741 >SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6) Length = 372 Score = 47.2 bits (107), Expect = 9e-06 Identities = 21/48 (43%), Positives = 27/48 (56%) Frame = +2 Query: 254 NEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHQF 397 +EA K T K+PI H IV +WD ME+ W + LR PE+H F Sbjct: 288 DEAIDKPSYAT-KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPEDHYF 334 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 41.1 bits (92), Expect = 6e-04 Identities = 19/55 (34%), Positives = 31/55 (56%) Frame = +1 Query: 391 PVLLTEXPLNPKANREKMTQXMFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFG 555 P+L++E N + REK+T+ MFE +N PA ++ +VL + V+D G Sbjct: 35 PLLMSEAAWNTRIKREKLTELMFEKYNVPAFFLCKNSVLTAFANGRSNGLVIDSG 89 >SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = -1 Query: 209 MAGPSHDRGEHGARSIFSCETGLAHTGAIV 120 MA + D GE+G+ SI S ETGLAHTGAI+ Sbjct: 1 MARSADDGGENGSGSIVSGETGLAHTGAII 30 >SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) Length = 152 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/36 (58%), Positives = 23/36 (63%) Frame = +1 Query: 454 MFEXFNTPAMYVAIQAVLCCTRSVVPXVFVLDFGDG 561 MFE FN+PA+YVAIQAVL S V D GDG Sbjct: 2 MFEAFNSPAVYVAIQAVLSLYASGRTTGVVFDSGDG 37 >SB_18097| Best HMM Match : NadA (HMM E-Value=2.2) Length = 272 Score = 32.3 bits (70), Expect = 0.28 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 V+LSH + H M D +HG RS FSCET L T Sbjct: 224 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVPT 259 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 31.9 bits (69), Expect = 0.37 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 V+LSH + H M D +HG RS FSCET L T Sbjct: 419 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 454 >SB_21074| Best HMM Match : NadA (HMM E-Value=2) Length = 358 Score = 31.9 bits (69), Expect = 0.37 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 V+LSH + H M D +HG RS FSCET L T Sbjct: 282 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 317 >SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) Length = 339 Score = 31.9 bits (69), Expect = 0.37 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 V+LSH + H M D +HG RS FSCET L T Sbjct: 260 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 295 >SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 31.9 bits (69), Expect = 0.37 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 V+LSH + H M D +HG RS FSCET L T Sbjct: 102 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 31.9 bits (69), Expect = 0.37 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 V+LSH + H M D +HG RS FSCET L T Sbjct: 102 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137 >SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 31.9 bits (69), Expect = 0.37 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 V+LSH + H M D +HG RS FSCET L T Sbjct: 136 VVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 171 >SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 0.49 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 184 GNTARGASSPAKPALHIPEPLSTT 113 GNT R PAKPAL++P P S T Sbjct: 80 GNTNRRTRIPAKPALNLPSPPSKT 103 >SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8) Length = 170 Score = 31.5 bits (68), Expect = 0.49 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -2 Query: 184 GNTARGASSPAKPALHIPEPLSTT 113 GNT R PAKPAL++P P S T Sbjct: 80 GNTNRRTRIPAKPALNLPSPPSKT 103 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 31.5 bits (68), Expect = 0.49 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 ++LSH + H M D +HG RS FSCET L T Sbjct: 184 IVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 219 >SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 749 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 184 GNTARGASSPAKPALHIPEPLSTT 113 GNT R PAKP+L++P P S T Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563 >SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17) Length = 635 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +2 Query: 179 VPLDRGKAPPSGRDGRYGTEGLLCRNEAQSKRGILTLKYPIEHGIVTNW--DDMEKIWHH 352 V L + +GR+ G+ +CR +A ++TL + I G+ + D EK+W+H Sbjct: 441 VTLSQNVVSVTGREESGGSGTQVCRKKAP----LITLSHVIRMGLALSLVSDVKEKVWYH 496 Query: 353 TFYN 364 T N Sbjct: 497 TCPN 500 >SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1259 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 411 SPQPQGQQREDDPXHVRXIQHARHVRRHPSR 503 SP P+ R D+P V A HV HPSR Sbjct: 265 SPTPKRCVRFDEPPTVEKYSKASHVTEHPSR 295 >SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) Length = 580 Score = 29.9 bits (64), Expect = 1.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 296 PIEHGIVTNWDDMEKIWHHTFYNE 367 P + G + NWD ++IW +TF E Sbjct: 292 PFQKGFLVNWDVEKQIWDYTFGKE 315 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 99 EVAALVVDNGSGMCKAGFAGEDAPRAV 179 ++A LV+D G+ K GFA APR++ Sbjct: 232 KMATLVLDCGACSQKIGFASNQAPRSI 258 >SB_37416| Best HMM Match : ResIII (HMM E-Value=1.2) Length = 563 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 455 CSXHSTRPPCTSPSKPCSAVRVRSYXRY 538 C H+ R P T+PS PC V S Y Sbjct: 360 CYSHARREPSTAPSLPCDLVAATSAKMY 387 >SB_56842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 318 VTIPCSMGYLRVRIPLLLCASFLHKSPSVP 229 V PC M LRVR+ C S LH + P Sbjct: 60 VACPCCMSLLRVRVVCPCCMSVLHVRVACP 89 >SB_28400| Best HMM Match : PMSR (HMM E-Value=1.7e-24) Length = 766 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 105 AALVVDNGSGMCKAGFAGEDAPRAVFPSIVGRPRH 209 + +++D GS KAGFA E+A + + S++G H Sbjct: 483 SVIIIDLGSSSVKAGFAQEEA-QVFYISLIGILEH 516 >SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 184 GNTARGASSPAKPALHIPEPLSTT 113 GNT R AKPAL++P P S T Sbjct: 40 GNTNRRTRIQAKPALNLPSPPSKT 63 >SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 635 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 Query: 184 GNTARGASSPAKPALHIPEPLSTT 113 GNT R PAKP L IP P + T Sbjct: 68 GNTNRRTRIPAKPTLTIPSPPTKT 91 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H L A +HG RS FSCET L Sbjct: 4 IVLSHLNKH-LSAFNILSEMQHGFRSGFSCETQL 36 >SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) Length = 168 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 257 HSYIRVLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 H +++H D H ++ + +HG R FSCET L T Sbjct: 44 HIIFHDIMNHLDTHNILV-----KFQHGFRRFFSCETQLITT 80 >SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) Length = 252 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 257 HSYIRVLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 H +++H D H ++ + +HG R FSCET L T Sbjct: 89 HIIFHDIMNHLDTHNILV-----KFQHGFRRFFSCETQLITT 125 >SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 257 HSYIRVLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 H +++H D H ++ + +HG R FSCET L T Sbjct: 673 HIIFHDIMNHIDTHNILV-----KFQHGFRRFFSCETQLITT 709 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 257 HSYIRVLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 H +++H D H ++ + +HG R FSCET L T Sbjct: 292 HIIFHDIMNHLDTHNILV-----KFQHGFRRFFSCETQLITT 328 >SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) Length = 560 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 257 HSYIRVLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 H +++H D H ++ + +HG R FSCET L T Sbjct: 503 HIIFHDIMNHLDTHNILV-----KFQHGFRRFFSCETQLITT 539 >SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 979 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -1 Query: 257 HSYIRVLLSHTDHHALMAGPSHDRGEHGARSIFSCETGLAHT 132 H +++H D H ++ + +HG R FSCET L T Sbjct: 129 HIIFHDIMNHLDTHNILV-----KFQHGFRRFFSCETQLITT 165 >SB_57561| Best HMM Match : fn3 (HMM E-Value=0) Length = 1614 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -1 Query: 218 HALMAGPSH--DRGEHGARSIFSCETGLAHTGAIVY 117 ++L+A P + G H + S+F+C T +A G VY Sbjct: 319 YSLIATPLNGTSAGAHNSISVFTCNTSVAIAGLAVY 354 >SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) Length = 291 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 V+LSH + H L A +HG R+ FSCET L Sbjct: 4 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQL 36 >SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H D +HG RS FSCET L Sbjct: 140 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 172 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H D +HG RS FSCET L Sbjct: 4 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 36 >SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 212 GRDGRYGTEGLLCRNEAQSKRGIL-TLKYPIEHGIVTNWDDMEKIWHHTF 358 GR G + GL N+ S I L+ P + +VT+++ E++ H F Sbjct: 105 GRKGEPDSGGLAVGNDIGSVEMIRWALRTPFDRDVVTHYECQEQVLDHAF 154 >SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9) Length = 209 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 V+LSH + H L A +HG R+ FSCET L Sbjct: 104 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQL 136 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H D +HG RS FSCET L Sbjct: 481 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 513 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 V+LSH + H L A +HG R+ FSCET L Sbjct: 104 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQL 136 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 V+LSH + H L A +HG R+ FSCET L Sbjct: 474 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQL 506 >SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 199 LPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 89 L IE + A++P P + +P+ + +AAT +SH Sbjct: 222 LRRIERSNIPQATAPGTPGVPVPQAVHGVSAATQASH 258 >SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 411 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H D +HG RS FSCET L Sbjct: 89 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 121 >SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) Length = 221 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 V+LSH + H L A +HG R+ FSCET L Sbjct: 137 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQL 169 >SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) Length = 224 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 V+LSH + H L A +HG R+ FSCET L Sbjct: 54 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQL 86 >SB_53316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 27.5 bits (58), Expect = 8.0 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 345 GIIPSTM-SCVSPPRNTSSAH*GSPQPQGQQREDD-PXHVRXIQHARHVRRH 494 G +PS++ S VS +A G+ G QR D P H + I + RH + H Sbjct: 53 GYLPSSIRSEVSAKARLPTARKGAWITHGAQRLIDYPQHAKVIDYPRHAKAH 104 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H D +HG RS FSCET L Sbjct: 1207 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 1239 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 V+LSH + H L A +HG R+ FSCET L Sbjct: 726 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQL 758 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H D +HG RS FSCET L Sbjct: 1871 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 1903 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H D +HG RS FSCET L Sbjct: 191 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 223 >SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H D +HG RS FSCET L Sbjct: 81 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 113 >SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H D +HG RS FSCET L Sbjct: 159 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 191 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 ++LSH + H D +HG RS FSCET L Sbjct: 220 IVLSHLNKHLSAFNILSDL-QHGFRSGFSCETQL 252 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -1 Query: 242 VLLSHTDHHALMAGPSHDRGEHGARSIFSCETGL 141 V+LSH + H L A +HG R+ FSCET L Sbjct: 810 VVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQL 842 >SB_10020| Best HMM Match : Extensin_2 (HMM E-Value=0.88) Length = 379 Score = 27.5 bits (58), Expect = 8.0 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 330 SSQLVTI--PCSMGYLRV-RIPLLLCASFLHKSPSVPYRP 220 S LV++ P S Y + RIP LC L PS PY+P Sbjct: 260 SPSLVSLQAPLSYSYKPLPRIPSSLCLLSLQAPPSYPYKP 299 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,429,799 Number of Sequences: 59808 Number of extensions: 414818 Number of successful extensions: 1475 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 1281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1474 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -