BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0485 (419 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 27 0.28 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 0.84 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 3.4 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 22 7.9 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 22 7.9 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 27.1 bits (57), Expect = 0.28 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = -1 Query: 386 DHIA--PSXREVPCRPTFVRPSCPGLLQRHDARKTSXRRIL 270 DH++ P REV R + + LL+ H KTS R+L Sbjct: 806 DHLSWLPHVREVTTRARKIADAVTRLLRNHSGPKTSKARLL 846 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.4 bits (53), Expect = 0.84 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +3 Query: 123 PPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 245 PPP+ + + + L + T E V ++C E G I+ P Sbjct: 756 PPPKPPTVTMMDMQQLDTQPTLEFKELVSQKCAERGIIFAP 796 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.4 bits (48), Expect = 3.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 107 NELRKTSATNRWHGLV 154 N L T+ATNR+ GLV Sbjct: 426 NGLHSTTATNRFSGLV 441 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 22.2 bits (45), Expect = 7.9 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 355 PAVQHSSVHRVQGFFSVTTLEKPXE 281 P H S HR+ G F + + P + Sbjct: 32 PRSPHGSGHRIVGGFEINVSDTPYQ 56 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 83 ELNIYTTQNELRKTSATNRWHGL 151 +L + N + TSA WHGL Sbjct: 122 DLIVVDITNAMAGTSAAIHWHGL 144 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 381,951 Number of Sequences: 2352 Number of extensions: 6610 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -