BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0482 (706 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 1.8 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 7.4 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 7.4 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 7.4 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 7.4 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 7.4 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 7.4 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 7.4 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 21 7.4 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 7.4 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 9.8 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = -3 Query: 182 GHNTISTHTTKSNITL 135 G NTI+ H+T+S++T+ Sbjct: 536 GTNTITRHSTESSLTI 551 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.4 bits (43), Expect = 7.4 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 457 DSGAWKGWISPSTKSN 410 + GAW G+ P T N Sbjct: 374 EGGAWVGYEDPDTAGN 389 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 365 RVMSWKKFSKVLPLLVYYYHL 303 R M WKK K+ + + YH+ Sbjct: 271 RRMKWKKEHKMASMNIVPYHM 291 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 365 RVMSWKKFSKVLPLLVYYYHL 303 R M WKK K+ + + YH+ Sbjct: 271 RRMKWKKEHKMASMNIVPYHM 291 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +2 Query: 194 LYFLMIDVESTGFYNSHGIIPVGKHLAFIPSSKTVIPG 307 LYF + + F H ++ + + + + SKTV G Sbjct: 459 LYFQLCEFSRLNFSVEHLLMELSRAIDSVACSKTVSDG 496 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 365 RVMSWKKFSKVLPLLVYYYHL 303 R M WKK K+ + + YH+ Sbjct: 271 RRMKWKKEHKMASMNIVPYHM 291 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 365 RVMSWKKFSKVLPLLVYYYHL 303 R M WKK K+ + + YH+ Sbjct: 227 RRMKWKKEHKMASMNIVPYHM 247 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 365 RVMSWKKFSKVLPLLVYYYHL 303 R M WKK K+ + + YH+ Sbjct: 271 RRMKWKKEHKMASMNIVPYHM 291 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 365 RVMSWKKFSKVLPLLVYYYHL 303 R M WKK K+ + + YH+ Sbjct: 59 RRMKWKKEHKMASMNIVPYHM 79 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 365 RVMSWKKFSKVLPLLVYYYHL 303 R M WKK K+ + + YH+ Sbjct: 271 RRMKWKKEHKMASMNIVPYHM 291 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 705 PLVTTDEGDKFGK 667 P+VT DEG GK Sbjct: 2 PIVTIDEGKLLGK 14 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,536 Number of Sequences: 336 Number of extensions: 3544 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -