BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0481 (747 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 26 1.1 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 26 1.4 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 3.3 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 24 5.7 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 24 5.7 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 24 5.7 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 23 7.6 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 23 7.6 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 7.6 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 23 7.6 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 26.2 bits (55), Expect = 1.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 656 EVEQRVHNRQGHEGVHLAAARQGDPPHHR 742 E +QR + Q H G AAA PP HR Sbjct: 896 EQQQRSSSSQQHRGPGAAAATGPPPPTHR 924 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 1.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 635 NGTHLRHEVEQRVHNRQGHEGVHLAAA 715 N +HL H + H+ G EGV + A Sbjct: 1310 NSSHLHHHLHHGHHHHHGGEGVPMGPA 1336 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -1 Query: 654 WRRCVPLESLMCTMSKEPGCLSRDTMVPTRPKLRPPVIIH 535 +RR P + T S P R RP RP ++ H Sbjct: 666 YRRTTPTTTTTTTASPAPAPAIRSRFGDNRPSWRPLIVPH 705 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 681 GKGTKAYISLPRGKGIRLTIGR 746 G+ Y+SLP G G R IGR Sbjct: 40 GQKIHPYVSLPFGYGRRTCIGR 61 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +3 Query: 18 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 164 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.8 bits (49), Expect = 5.7 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -1 Query: 672 TRCSTSWRRCVPLESLMCTMSKEPGCLSRDTMVP 571 T C+ P+E L C E G +SRD P Sbjct: 389 TMCAVKEAPHTPIEKLRCYRCLERGHVSRDCHSP 422 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +3 Query: 18 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 164 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCY 81 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +3 Query: 18 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 164 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 29 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCY 77 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 440 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 351 AD AA +RY + + RH L + Q ++S Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 23.4 bits (48), Expect = 7.6 Identities = 15/60 (25%), Positives = 22/60 (36%) Frame = -2 Query: 197 CFTIFRTSFPVKAYFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAFKRFKC 18 C + + PV +R R + RG +R+ PVD A +A KC Sbjct: 373 CISSIMEAMPVSVDRQRCYRCLERGHLARDCQSPVDRQQACIRCGADGHYAKSCTSEIKC 432 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 878,057 Number of Sequences: 2352 Number of extensions: 20539 Number of successful extensions: 105 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -