BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0472 (798 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 51 4e-08 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 3.6 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 24 4.7 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 24 4.7 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 24 4.7 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 24 4.7 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 24 4.7 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 4.7 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 24 4.7 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 24 4.7 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 24 4.7 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 4.7 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 4.7 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 4.7 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 4.7 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 4.7 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 24 4.7 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 4.7 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 4.7 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 24 4.7 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 24 4.7 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 24 4.7 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 24 4.7 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 24 4.7 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 24 4.7 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 24 4.7 AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-tran... 24 4.7 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 6.3 X98185-1|CAA66860.1| 123|Anopheles gambiae histone H2B protein. 23 8.3 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 51.2 bits (117), Expect = 4e-08 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 3/79 (3%) Frame = +3 Query: 276 ESTQGDTANDFIEGLRHFDKDGNGFISSAELRHLLSTLGEKLSDDEVEQLLQ---GQEDS 446 E QG DF+E L+ +DK+ +G + AEL H L+ LGE+L D E++ +++ ED Sbjct: 78 EKEQG-CFEDFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMKDCMDPEDD 136 Query: 447 QGNINYENFVHLIMQG*VL 503 GNI Y F+ +M V+ Sbjct: 137 DGNIPYAPFLKKMMDNMVV 155 Score = 38.3 bits (85), Expect = 3e-04 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = +2 Query: 77 QLAEFQEAFQLFDSRGDGKIHVAQIGDALRALGQNPT-ESDVKKCTLHLKPDERISFEVF 253 ++ + Q F ++D G G++ +G+ALRAL NPT E K + +++I FE F Sbjct: 9 EIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPTIELIGKMGGTQKRGEKKIKFEEF 68 Query: 254 RQFTRPYRKHAGRHC 298 +K + C Sbjct: 69 LPIFSQVKKEKEQGC 83 Score = 27.5 bits (58), Expect = 0.51 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 86 EFQEAFQLFDSRGDGKIHVAQIGDALRALGQ 178 +F E +L+D DG + +A++ +L ALG+ Sbjct: 86 DFLECLKLYDKNEDGTMLLAELTHSLTALGE 116 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 231 KGYL--LRCFANLPGHIESTQGDTANDFIEGLRHF 329 KGY+ CF HIE T++ F+ LR F Sbjct: 1446 KGYISIFVCFVTKAVHIELVSNLTSSAFLAALRRF 1480 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 242 FSQNLEHFDLRGNGF 256 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 257 FSQNLEHFDLRGNGF 271 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 306 FIEGLRHFDKDGNGF 350 F + L HFD GNGF Sbjct: 182 FSQNLEHFDLRGNGF 196 >AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-transferase E2 protein. Length = 221 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 80 IDPLNIQPYYESTNEIEGNEIGIF 9 ID L PYYE N G ++G F Sbjct: 187 IDRLKQLPYYEEANGGGGTDLGKF 210 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.8 bits (49), Expect = 6.3 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 528 ICKLTKSVTIQLEP*WDTVNKNL 596 +C+ TK +T L+ WD + L Sbjct: 1066 VCEATKRITSALQQDWDETRREL 1088 >X98185-1|CAA66860.1| 123|Anopheles gambiae histone H2B protein. Length = 123 Score = 23.4 bits (48), Expect = 8.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 322 RRPSIKSLAVSPCVLSIWPGKLAKH 248 +R +I S + V + PG+LAKH Sbjct: 83 KRSTITSREIQTAVRLLLPGELAKH 107 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 773,620 Number of Sequences: 2352 Number of extensions: 14808 Number of successful extensions: 71 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -