BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0472 (798 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 24 1.4 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 24 1.4 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 2.5 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 2.5 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.5 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 2.5 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 5.7 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 5.7 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.7 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 5.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.7 AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin prot... 22 5.7 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 7.6 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -1 Query: 618 RMFKYILINFC*QCPIMALTVWLQTWL 538 R F Y LI C ++ + W+ WL Sbjct: 239 REFSYYLIQIYIPCCMLVIVSWVSFWL 265 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -1 Query: 618 RMFKYILINFC*QCPIMALTVWLQTWL 538 R F Y LI C ++ + W+ WL Sbjct: 239 REFSYYLIQIYIPCCMLVIVSWVSFWL 265 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 2.5 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 606 YILINFC*QCPIMALTVWLQTWLVY 532 Y+++ FC C V+ TWL Y Sbjct: 347 YVIVPFCPDCCPSDRMVYFITWLGY 371 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 2.5 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 606 YILINFC*QCPIMALTVWLQTWLVY 532 Y+++ FC C V+ TWL Y Sbjct: 347 YVIVPFCPDCCPSDRMVYFITWLGY 371 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.4 bits (48), Expect = 2.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 767 MITYLHLMXKCIQV*LW 717 M TYLHL+ + + V +W Sbjct: 47 MFTYLHLLYQDVHVMIW 63 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 2.5 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 606 YILINFC*QCPIMALTVWLQTWLVY 532 Y+++ FC C V+ TWL Y Sbjct: 347 YVIVPFCPDCCPSDRMVYFITWLGY 371 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 5.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 287 LRAFDMAW*IGETPQKISFHQ 225 L AFDMA I TP++I + Q Sbjct: 314 LSAFDMARIIQITPKRIQYAQ 334 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.2 bits (45), Expect = 5.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 287 LRAFDMAW*IGETPQKISFHQ 225 L AFDMA I TP++I + Q Sbjct: 352 LSAFDMARIIQITPKRIQYAQ 372 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 92 QEAFQLFDS-RGDGKIHVAQIGDAL 163 + +F ++ S +GDGK H+ G+ L Sbjct: 170 EPSFYIYPSLQGDGKFHLLPTGELL 194 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.2 bits (45), Expect = 5.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 176 QNPTESDVKKCTLHLKPDERISFEVFRQFT 265 + P+E D+K+ T E IS FR T Sbjct: 350 EQPSEEDLKRITNQPSEGEDISDYKFRHIT 379 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 92 QEAFQLFDS-RGDGKIHVAQIGDAL 163 + +F ++ S +GDGK H+ G+ L Sbjct: 170 EPSFYIYPSLQGDGKFHLLPTGELL 194 >AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin protein. Length = 124 Score = 22.2 bits (45), Expect = 5.7 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 420 QLLQGQEDSQGNINYENF 473 Q +QG+E + ++N ENF Sbjct: 35 QEMQGKEKNSASLNSENF 52 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 7.6 Identities = 11/52 (21%), Positives = 26/52 (50%) Frame = -1 Query: 690 DILNILLSLTYICSL*VYIYVAQIRMFKYILINFC*QCPIMALTVWLQTWLV 535 D+ S+ +C++ + Y+A R Y I + ++ TVW+ ++++ Sbjct: 145 DVWMCTASILNLCAISLDRYLAVTRPVSYPQIMSPRRARLLVATVWILSFVI 196 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,178 Number of Sequences: 438 Number of extensions: 4297 Number of successful extensions: 22 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -