BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0469 (538 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 4.9 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 23 6.5 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 23 6.5 U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles ... 23 8.6 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 8.6 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 4.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 253 LVRFFACSSSWPFLNL 206 L+R F + SWP LNL Sbjct: 903 LLRVFKLAKSWPTLNL 918 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 23.0 bits (47), Expect = 6.5 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 27 VRSNKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCE 146 VR+N G C Y + PG K+ K+D F F + +CE Sbjct: 113 VRNN--GSCLY----VPPGIFKSTCKIDITWFPFDDQRCE 146 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 23.0 bits (47), Expect = 6.5 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 27 VRSNKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCE 146 VR+N G C Y + PG K+ K+D F F + +CE Sbjct: 145 VRNN--GSCLY----VPPGIFKSTCKIDITWFPFDDQRCE 178 >U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S8 mRNA, complete cds. ). Length = 135 Score = 22.6 bits (46), Expect = 8.6 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 201 RRKFKKGQEEEQAKKRTR 254 +R+ K G+E+ +KKRT+ Sbjct: 53 KRELKAGEEDVLSKKRTK 70 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 22.6 bits (46), Expect = 8.6 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = -1 Query: 307 HNVTK*STNNRTLELLGPLVRFFACSSSWPFLNLRLYRTVHVTLRGFLL 161 H V T+N T GPL C WP +R ++ ++ F+L Sbjct: 235 HGVALNGTDNAT----GPLSSAMYCEELWPSEEMRKTFSIVTSILQFVL 279 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 395,691 Number of Sequences: 2352 Number of extensions: 6602 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -