BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0465 (744 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 2.6 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 6.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 7.9 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +3 Query: 528 HRQVWFRNSXADSCXSWYWYCV 593 HR +FR + W+W+ V Sbjct: 192 HRLAYFREDLGINLHHWHWHLV 213 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 448 KDNSASNGSGDFLAALHTQTNMTVVVANGNK 356 K NS +NGS D + ++ + NG+K Sbjct: 279 KPNSTTNGSPDVIKVEPELSDSEKTLCNGSK 309 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 655 ELTCSNPVHQP 623 E TC PVH+P Sbjct: 91 EPTCDEPVHRP 101 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,736 Number of Sequences: 336 Number of extensions: 3023 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -