BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0465 (744 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 164 8e-41 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.99 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 30 1.7 SB_52533| Best HMM Match : rve (HMM E-Value=2) 30 1.7 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 4.0 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 4.0 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 7.0 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 7.0 SB_57639| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) 28 9.2 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 164 bits (398), Expect = 8e-41 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 1/101 (0%) Frame = +2 Query: 206 QTRXHLLVF-FTNQRIRXIDFFLGXSLNDEVLKIMPVXKQTRAGQRTRFKAFVAIGDNNG 382 +T H+ +F + IDFFLG +L DEVLKIMPV KQTRAGQRTRFKAFVAIGD+NG Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83 Query: 383 HIGLGVKCSKEVATAIRGAIILAKLSVLPVRRGYWGNKIGK 505 H+GLGVKCSKEVATAIRGAIILAKLSV+PVRRGYWGNKIGK Sbjct: 84 HVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGK 124 Score = 106 bits (254), Expect = 2e-23 Identities = 47/57 (82%), Positives = 50/57 (87%) Frame = +1 Query: 502 KANTVPCKVTGKCGSVTVRLIPAPRGTGIVSAPXPKKLLQMAGVQDCYTSARGSTGT 672 K +TVPCKVTGKCGS VRLIPAPRGTGIVSAP PKKLLQMAG++DCYTS RG T T Sbjct: 124 KPHTVPCKVTGKCGSTRVRLIPAPRGTGIVSAPVPKKLLQMAGIEDCYTSTRGQTAT 180 Score = 54.0 bits (124), Expect = 1e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 156 WVPVTKLGRLVREGKIDKLXSIYLFSLPIKEF 251 WVPVTKLGRLV++ KI L IYLFSLPIKEF Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKEF 39 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 31.1 bits (67), Expect = 0.99 Identities = 19/66 (28%), Positives = 31/66 (46%) Frame = -3 Query: 457 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFXYRHDLKNLIIQG 278 ++ + NS N D TNMT + + G CL + TC+ DL NL+ + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCM-SLDPDLGNLMSRS 292 Query: 277 RXEEEI 260 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 31.1 bits (67), Expect = 0.99 Identities = 19/66 (28%), Positives = 31/66 (46%) Frame = -3 Query: 457 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFXYRHDLKNLIIQG 278 ++ + NS N D TNMT + + G CL + TC+ DL NL+ + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCM-SLDPDLGNLMSRS 576 Query: 277 RXEEEI 260 R ++E+ Sbjct: 577 RNQDEL 582 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +2 Query: 242 QRIRXIDFFLGXSLNDEVLKIMPVXKQTRAGQRTRFKAFVAIGDNNGHIGLG 397 QR+R L N +LK++ + Q +A + F+ FVA + H G G Sbjct: 141 QRLRGKANGLVERTNRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +2 Query: 242 QRIRXIDFFLGXSLNDEVLKIMPVXKQTRAGQRTRFKAFVAIGDNNGHIGLG 397 QR+R L N +LK++ + Q +A + F+ FVA + H G G Sbjct: 81 QRLRSKANGLVERTNRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 284 NDEVLKIMPVXKQTRAGQRTRFKAFVAIGDNNGHIGLG 397 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 284 NDEVLKIMPVXKQTRAGQRTRFKAFVAIGDNNGHIGLG 397 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 284 NDEVLKIMPVXKQTRAGQRTRFKAFVAIGDNNGHIGLG 397 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +2 Query: 284 NDEVLKIMPVXKQTRAGQRTRFKAFVAIGDNNGHIGLG 397 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 7.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 334 TAHTFQGICCHWRQQRSYW 390 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 332 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 421 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 >SB_57639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 604 PKKLLQMAGVQDCYTSARGSTGTWEILLKPHTLPL 708 P+ + Q G+ CY G G W LL P T P+ Sbjct: 7 PQLIQQYRGIVGCYRRLCGILGVWR-LLNPETDPI 40 >SB_8063| Best HMM Match : Homeobox (HMM E-Value=8.5e-24) Length = 963 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -1 Query: 459 DSLARIIAPRMAVATSLLHFTPKPI*PLLSPMATNALKRVRCPA 328 D+L+ IAP A SLL + P+++P A +AL ++ P+ Sbjct: 365 DALSLQIAPSANNALSLLKGAYDALSPMIAPSANDALSLLKAPS 408 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,057,460 Number of Sequences: 59808 Number of extensions: 421113 Number of successful extensions: 1039 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1039 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -