BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0463 (715 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 28 0.076 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.6 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 28.3 bits (60), Expect = 0.076 Identities = 21/70 (30%), Positives = 33/70 (47%) Frame = +2 Query: 320 TELPKDSRSSKRMCSLSVNQATESVLAHCTVSWSSAHLNLRCATLKLTASTWVNFAVFSE 499 T L DSRS++RM + SVN +L + W H + + L + +VF+ Sbjct: 272 TVLWLDSRSTERMIAASVNLICH-ILCMSDLHWQLPHNSTNPPNILLYYRDSLALSVFAL 330 Query: 500 TVTRALR*LQ 529 +T LR +Q Sbjct: 331 ILTALLRKMQ 340 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 629 SPAARCIPPPRL 664 +P RC PPPR+ Sbjct: 1696 APNRRCPPPPRM 1707 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,561 Number of Sequences: 438 Number of extensions: 4957 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -