Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0463
         (715 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholi...    28   0.076
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              22   6.6  

>DQ026037-1|AAY87896.1|  431|Apis mellifera nicotinic acetylcholine
           receptor alpha9subunit protein.
          Length = 431

 Score = 28.3 bits (60), Expect = 0.076
 Identities = 21/70 (30%), Positives = 33/70 (47%)
 Frame = +2

Query: 320 TELPKDSRSSKRMCSLSVNQATESVLAHCTVSWSSAHLNLRCATLKLTASTWVNFAVFSE 499
           T L  DSRS++RM + SVN     +L    + W   H +     + L     +  +VF+ 
Sbjct: 272 TVLWLDSRSTERMIAASVNLICH-ILCMSDLHWQLPHNSTNPPNILLYYRDSLALSVFAL 330

Query: 500 TVTRALR*LQ 529
            +T  LR +Q
Sbjct: 331 ILTALLRKMQ 340


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 629  SPAARCIPPPRL 664
            +P  RC PPPR+
Sbjct: 1696 APNRRCPPPPRM 1707


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 211,561
Number of Sequences: 438
Number of extensions: 4957
Number of successful extensions: 8
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22048515
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)