BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0461 (686 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H5.08c |||WD repeat protein Wdr44 family|Schizosaccharomyce... 29 0.63 SPCC320.12 ||SPCC330.17c|mitochondrial inner membrane peptidase ... 28 1.5 SPAC328.06 |ubp2||ubiquitin C-terminal hydrolase Ubp2|Schizosacc... 27 2.5 SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schi... 27 3.4 SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pom... 26 5.9 >SPAC3H5.08c |||WD repeat protein Wdr44 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 855 Score = 29.1 bits (62), Expect = 0.63 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 306 LFVPIYLLVTLRGYASFTASALSSAWNKQNHVLS 407 L P++ +R YA TA L +W++ N +LS Sbjct: 292 LKAPVFSEAPIREYAGHTADILDLSWSRNNFLLS 325 >SPCC320.12 ||SPCC330.17c|mitochondrial inner membrane peptidase Atp23|Schizosaccharomyces pombe|chr 3|||Manual Length = 185 Score = 27.9 bits (59), Expect = 1.5 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 245 ELTRPFGEHRINYDWRY*NKTFCSYLFAGNLEGLC 349 E+ F +HR DW CS + A ++ G C Sbjct: 87 EMIHMFDDHRFEVDWNNLRHQACSEIRASSMSGEC 121 >SPAC328.06 |ubp2||ubiquitin C-terminal hydrolase Ubp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1141 Score = 27.1 bits (57), Expect = 2.5 Identities = 20/50 (40%), Positives = 23/50 (46%) Frame = +1 Query: 460 EYSVYLTNNIEYSTVYDVSIIMYGARYCCAMSYMLLYYGVV*KQXYNHII 609 E +VY N EY TV D S I A YML Y ++ Y HII Sbjct: 1085 ENNVYRKYNDEYVTVVDESEIFADTTGNNANPYMLTYI----RKEYRHII 1130 >SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 26.6 bits (56), Expect = 3.4 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 513 VHNNVWSAILLCYELYAIILWRSLKAG 593 VH +++ L+C +Y +LW + AG Sbjct: 363 VHTVIYTITLICITIYFSLLWMNATAG 389 >SPBC776.13 |cnd1||condensin subunit Cnd1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1158 Score = 25.8 bits (54), Expect = 5.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 384 NKQNHVLSCFQTTLY 428 N QNHVLSC++T + Sbjct: 590 NIQNHVLSCYKTLFF 604 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,633,447 Number of Sequences: 5004 Number of extensions: 50235 Number of successful extensions: 95 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -