BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0461 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 29 4.7 SB_22488| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) 28 8.1 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -3 Query: 660 EFVRLKIFSSSYTGPCRNYMIVXLLSDYAII**HIAHSTTVSRSIHYYG 514 E V L++F+ T R +V +L D + I HS +SR H YG Sbjct: 110 ETVLLRVFNDILTAIDRQQEVVLVLLDLSAAFDTIEHSALLSRMQHRYG 158 >SB_22488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +1 Query: 493 YSTVYDVSIIMYGARYCCAMSYMLLYYGVV*KQXYNHIISTW 618 Y VY +++++ +YC + +M + Y + K Y+ + TW Sbjct: 182 YRKVY--TMVLFLVQYCIPLIFMTIMYTMTLKSLYSASLKTW 221 >SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) Length = 872 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 71 LRSQV*LQRLPYPSNRNALLLHG 3 LR Q +QR P P+ RN++ LHG Sbjct: 24 LRQQNQVQRRPEPTPRNSIFLHG 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,545,734 Number of Sequences: 59808 Number of extensions: 374841 Number of successful extensions: 604 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -