BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0458 (764 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2244| Best HMM Match : zf-CCCH (HMM E-Value=0.004) 36 0.027 SB_18599| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 >SB_2244| Best HMM Match : zf-CCCH (HMM E-Value=0.004) Length = 445 Score = 36.3 bits (80), Expect = 0.027 Identities = 24/53 (45%), Positives = 32/53 (60%) Frame = +3 Query: 495 KTTSWCLSGLLSNNGGIKRRNEVQRIARLMSKYSKKLVSKCIYIPILKCTETE 653 KT L LL G IK + +V RI LM + ++KL+S+C+YI ILK T E Sbjct: 45 KTLLNALKPLLGFAGDIKSQ-DVMRIISLM-RDAEKLMSRCVYINILKATIVE 95 >SB_18599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1501 Score = 29.1 bits (62), Expect = 4.1 Identities = 21/82 (25%), Positives = 41/82 (50%) Frame = +3 Query: 519 GLLSNNGGIKRRNEVQRIARLMSKYSKKLVSKCIYIPILKCTETELLDLFLRYXGWLLIH 698 G+L + G + + ++ ++ + K+L+ K + L+C+E EL DL + L + Sbjct: 293 GILLDQGKLNKFESLELCKPVLQQGKKQLLEKWLKEEKLECSE-ELGDLVKQVDPTLALS 351 Query: 699 LWLTESLVSQKLASCERITGSF 764 ++L + V K+ C TG F Sbjct: 352 VYLRAN-VPAKVIQCFAETGQF 372 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,255,391 Number of Sequences: 59808 Number of extensions: 368707 Number of successful extensions: 745 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -