BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0455 (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 1.9 AY994093-1|AAX86006.1| 45|Anopheles gambiae metallothionein 1 ... 24 3.3 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 23 4.4 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 7.6 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 7.6 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 24.6 bits (51), Expect = 1.9 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 Query: 38 VVTELDDHPQQQCIPCEEAQYQKAVQQGAEQCD*PPLLQVQRLDSQ 175 V +L QQQ P ++ Q Q+ QQ + PP L+ QR Q Sbjct: 265 VPPQLRQQRQQQQRPRQQQQQQQQQQQQQGERYVPPQLRQQRQQQQ 310 >AY994093-1|AAX86006.1| 45|Anopheles gambiae metallothionein 1 protein. Length = 45 Score = 23.8 bits (49), Expect = 3.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 Query: 359 CISLCGSG*PLTTSSLCTVTS 297 C S CGSG P T C S Sbjct: 12 CTSGCGSGQPCATDCKCACAS 32 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 23.4 bits (48), Expect = 4.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 351 SVR*WLAFNNLFTLYSDLLAPALN 280 +V+ WLA NN+ T+ L+P LN Sbjct: 163 TVQTWLADNNVKTMKWPALSPDLN 186 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 7.6 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 230 QESKGYQKAAKNLIRRPFKAGARRSLYKVKRLLKANHYRTDLCKATL 370 + +K +K A + +RP A + L ++K N Y T+ + TL Sbjct: 485 RRTKQPKKRADSEEKRPRTAFSNAQLQRLKNEFNENRYLTEKRRQTL 531 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 7.6 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 230 QESKGYQKAAKNLIRRPFKAGARRSLYKVKRLLKANHYRTDLCKATL 370 + +K +K A + +RP A + L ++K N Y T+ + TL Sbjct: 485 RRTKQPKKRADSEEKRPRTAFSNAQLQRLKNEFNENRYLTEKRRQTL 531 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 481,172 Number of Sequences: 2352 Number of extensions: 8917 Number of successful extensions: 58 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -