BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0454 (682 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0599 + 20897093-20898357,20898507-20898589,20899840-208999... 28 7.9 06_03_0599 + 22632625-22633030,22634733-22636724,22636819-22637171 28 7.9 >12_02_0599 + 20897093-20898357,20898507-20898589,20899840-20899903, 20900057-20900354,20900385-20900426 Length = 583 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/51 (25%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = -1 Query: 550 YSPKSFFLFISWTM---EVQTFLLQKDGFYLVRYLALHINPALFFRIHDYP 407 Y+P+S F + WT+ E+ + +KD YL + P + + ++P Sbjct: 289 YTPESGFTIVCWTLRMDEMDKMVWEKDAVLKSDYLWSMLKPDFLWPLDEFP 339 >06_03_0599 + 22632625-22633030,22634733-22636724,22636819-22637171 Length = 916 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 271 YPNYNLQYYCNPKNHEEIKQ 330 +PN NL + +PK+HE I Q Sbjct: 694 FPNGNLDMWLHPKSHEHISQ 713 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,761,685 Number of Sequences: 37544 Number of extensions: 264105 Number of successful extensions: 690 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -