BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0446 (860 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66080.1 68414.m07500 expressed protein 31 1.3 At1g20610.1 68414.m02575 cyclin, putative similar to G2/mitotic-... 30 2.3 At2g37800.1 68415.m04641 DC1 domain-containing protein contains ... 28 9.2 >At1g66080.1 68414.m07500 expressed protein Length = 190 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +3 Query: 513 ENLVNFVASFSVTQDQMTPTPGVSYIPLNTLHTWYQNFERRLQQNPNFWKN 665 ENL NF+ SF +P++ L W++ F+ + +++P+F K+ Sbjct: 143 ENLFNFMQSFCGVDGSKL------VVPMDILDRWFKKFQEKAKRDPDFLKS 187 >At1g20610.1 68414.m02575 cyclin, putative similar to G2/mitotic-specific cyclins (B-like cyclin) from {Medicago varia} SP|P46278, SP|P46277; contains Pfam profiles PF00134: Cyclin, N-terminal domain, PF02984: Cyclin, C-terminal domain Length = 429 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 555 DQMTPTPGVSYIPLNTLHTWYQNFERRLQQNPNFWKN 665 D+ P V YI + +HT+Y+NFE+ PN+ N Sbjct: 167 DKNNPLAAVEYI--HDMHTFYKNFEKLSCVPPNYMDN 201 >At2g37800.1 68415.m04641 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 396 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 468 TPRNKQLCDICSEKLENL 521 T +NK++CDIC E E L Sbjct: 217 THQNKRMCDICDESAEGL 234 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,304,925 Number of Sequences: 28952 Number of extensions: 337833 Number of successful extensions: 830 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2009406400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -