BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0445 (681 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 3.9 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 5.1 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 24 5.1 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 24.2 bits (50), Expect = 3.9 Identities = 21/72 (29%), Positives = 28/72 (38%) Frame = +2 Query: 437 TTTIVRGPVAGTPDESIISDEEEPQWRALTIGANPFSPRLMTPKRMILTKEPLPCSPSRT 616 TTT +A P S + P WR L + P + TP T P + S T Sbjct: 674 TTTTTTASLAPAPAISSRFGDNRPSWRPLIV---PHATTTKTP-----TTTPPATTTSTT 725 Query: 617 HREPVSLKRSXG 652 R+P K + G Sbjct: 726 PRDPCYGKFNCG 737 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 559 DPEEDDSDEGAPAVFPKSDAQRARLAEAVXGHTA 660 D EE++ +E P V K + ARL+ + A Sbjct: 46 DGEEEEDEEEGPGVRQKQSSPPARLSSSASSTAA 79 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 570 LFGVISLGENGFAPIVKARHCG 505 + GV ++G + I+ ARHCG Sbjct: 276 MLGVDAIGMSTVHEIITARHCG 297 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,636 Number of Sequences: 2352 Number of extensions: 12751 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -