BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0439 (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1151 - 10822616-10823863 31 1.1 08_02_1138 + 24631919-24632248,24634100-24634502,24634788-246349... 29 4.5 05_06_0133 + 25905455-25905545,25905650-25906202,25906310-259068... 28 6.0 01_06_0160 - 27095727-27096008,27096164-27096652,27096983-270971... 28 6.0 02_05_0553 - 29918289-29918361,29918505-29918617,29918694-299188... 28 7.9 >07_01_1151 - 10822616-10823863 Length = 415 Score = 30.7 bits (66), Expect = 1.1 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = -3 Query: 439 LSFSITMSSVPY-WYSPPGTNTIISLDRCSSSTLSLIFSTEHCSLLLPEYKLFRSFSPFL 263 +S+S + +PY ++PP II L S LS I STE+ E+ L +S P Sbjct: 252 VSYSHLLPVMPYNAFNPPPLVCIIQLSLSQSMLLSSIKSTENLKYHAQEFALMKSNPPIA 311 Query: 262 FTLS-HNH 242 S H H Sbjct: 312 QRHSLHRH 319 >08_02_1138 + 24631919-24632248,24634100-24634502,24634788-24634982, 24635384-24635838,24636119-24636349,24636891-24637123, 24637899-24637971 Length = 639 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 397 SPPGTNTIISLDRCSSSTLSLIFSTEHCSLLLPEYKL 287 SPP T +I L SST+S + E + ++P Y+L Sbjct: 269 SPPFTTAMIILASVISSTVSNVLLGEKAAFIVPTYEL 305 >05_06_0133 + 25905455-25905545,25905650-25906202,25906310-25906806, 25906905-25907043,25907182-25907253,25907344-25907415, 25907503-25907583,25907899-25908065,25908148-25908416, 25908512-25908638,25908752-25908820,25908928-25909120, 25909215-25909707 Length = 940 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 246 LWLSVNRNGEKDR-NNLYSGNNNEQCSVENI--SDKVEDEQRSNEM 374 L L R G +D NN Y+GNNN+ S N+ +D+ D ++N M Sbjct: 878 LELEDRRCGMEDTYNNFYAGNNNDPNSSYNMYNTDQSTDVSQNNTM 923 >01_06_0160 - 27095727-27096008,27096164-27096652,27096983-27097132, 27097656-27097920,27097995-27098274,27100311-27100388, 27100597-27101240,27101334-27101412,27101489-27101612, 27101782-27101882,27102870-27103068 Length = 896 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/75 (24%), Positives = 32/75 (42%) Frame = -3 Query: 610 FPLKVLFRKSANTKLSPKISASVL*FVTLVKCLKPDLILHTYPKKKLLTLTIRFGPSLSF 431 F L TK +P + + L +++ + LKP + P + L + +I GP L Sbjct: 610 FDFSPLLSTQLATKYNPPVPTTSLPAISMQETLKPGGFSNAQPTQNLPSASIPSGPPLPQ 669 Query: 430 SITMSSVPYWYSPPG 386 +++ P P G Sbjct: 670 QLSVHPYPQPTLPLG 684 >02_05_0553 - 29918289-29918361,29918505-29918617,29918694-29918801, 29918991-29919206,29919284-29919559,29919720-29919824, 29919925-29920379,29920746-29920940,29921237-29921639, 29922006-29922518 Length = 818 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 397 SPPGTNTIISLDRCSSSTLSLIFSTEHCSLLLPEYKL 287 SPP T +I L SST+S + E + ++P Y+L Sbjct: 330 SPPFTTAMIILASVISSTVSNVLLGERPAFIVPAYEL 366 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,053,325 Number of Sequences: 37544 Number of extensions: 328967 Number of successful extensions: 782 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -