BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0437 (695 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual 26 5.9 SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces po... 26 5.9 >SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual Length = 653 Score = 25.8 bits (54), Expect = 5.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 350 NKNNNFVFRLICPPSDGFLLFILSLFYKSLVL 255 NK N++VFRL S F SLF ++L Sbjct: 214 NKKNSYVFRLFDRVSSSTFYFFNSLFAYFIIL 245 >SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 937 Score = 25.8 bits (54), Expect = 5.9 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 308 SDGFLLFILSLFYKSLVLYLSIEALQSLPGHL 213 ++G+L+ L LF K L+ +E +Q+ P HL Sbjct: 544 TEGYLMTDLVLFVKRLLSEAFVEKIQNGPKHL 575 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,475,943 Number of Sequences: 5004 Number of extensions: 45586 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -