BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0437 (695 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1320 - 35693575-35694846 32 0.38 03_06_0013 - 31007580-31007657,31007795-31007876,31007963-310080... 25 9.5 >02_05_1320 - 35693575-35694846 Length = 423 Score = 32.3 bits (70), Expect = 0.38 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = -1 Query: 329 FRLICPPSDGFLLFILSLFYKSLVLYLSIEALQSLPGHL 213 FR++ PPSD L +LS ++ + + +I+A ++LP L Sbjct: 138 FRIVTPPSDRALSALLSAYHDNRLYDRAIQAFRTLPAEL 176 >03_06_0013 - 31007580-31007657,31007795-31007876,31007963-31008065, 31008156-31008315,31009016-31009207,31009880-31010194 Length = 309 Score = 25.0 bits (52), Expect(2) = 9.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 317 CPPSDGFLLFILSLFYKSLVLYLSIEALQSL 225 C P F +LSLF KS +L+L + + L Sbjct: 109 CMPDRAFSWNVLSLFTKSGMLFLEVSLIAFL 139 Score = 21.0 bits (42), Expect(2) = 9.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -1 Query: 434 IWLILVLNYLW 402 +W + VLN LW Sbjct: 91 LWAVAVLNLLW 101 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,742,856 Number of Sequences: 37544 Number of extensions: 257384 Number of successful extensions: 390 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -