BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0434 (876 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4B3.04c |nte1||lysophospholipase|Schizosaccharomyces pombe|c... 29 0.87 SPAC11H11.02c |mug162||sequence orphan|Schizosaccharomyces pombe... 27 4.6 SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr ... 27 4.6 SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster ... 26 8.1 >SPCC4B3.04c |nte1||lysophospholipase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1316 Score = 29.1 bits (62), Expect = 0.87 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 303 KAAMFCGQMTSQWHEILVDVSFP*VSYFIG 392 +A FCG+M + W +L DV++P +Y G Sbjct: 1065 RAKKFCGRMANLWRFVL-DVTYPQAAYTTG 1093 >SPAC11H11.02c |mug162||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 264 Score = 26.6 bits (56), Expect = 4.6 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -3 Query: 292 KRFQCYQVLSINVLAHFILNIVEYYLFVEFIL 197 K + ++ I + HFILN++ + F E++L Sbjct: 136 KNWTIISIIEIPIKLHFILNVLLFLKFSEYML 167 >SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 962 Score = 26.6 bits (56), Expect = 4.6 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 10 DGFELRHIFMFCDKRQLYKISVATFKNQLRLLG 108 D F+L++I +CD+R + S +FK + LLG Sbjct: 622 DIFDLQNILRYCDERGDFS-SFPSFKKLISLLG 653 >SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 2|||Manual Length = 827 Score = 25.8 bits (54), Expect = 8.1 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +1 Query: 679 YGFASPTAYL*LYXGEYSSVPVGYTXGRLYILSPVAYLPQ 798 YG + PTA YS VP Y +SP + +PQ Sbjct: 709 YGSSMPTANGFYVPNTYSPVPFPYNTSYPPYMSPTSNMPQ 748 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,582,932 Number of Sequences: 5004 Number of extensions: 74338 Number of successful extensions: 119 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 438479610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -