BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0434 (876 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1263 + 35316083-35316185,35317167-35317220,35317665-353179... 29 4.9 >02_05_1263 + 35316083-35316185,35317167-35317220,35317665-35317903, 35317989-35318089,35318390-35318583,35318885-35319003, 35319624-35319749,35320081-35320142,35320265-35320348, 35320580-35320664 Length = 388 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/51 (35%), Positives = 22/51 (43%) Frame = +1 Query: 664 DWRKPYGFASPTAYL*LYXGEYSSVPVGYTXGRLYILSPVAYLPQGKVGVY 816 D P +SP Y L Y VPVGY ++ + V Y P G G Y Sbjct: 216 DVHYPPNLSSPFPYAGLGFPSYPGVPVGYMIPQVPYNNAVNYGPNGYGGRY 266 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,949,949 Number of Sequences: 37544 Number of extensions: 428730 Number of successful extensions: 706 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -