BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0434 (876 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_45576| Best HMM Match : LRR_1 (HMM E-Value=2.7e-14) 28 8.6 >SB_49165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 398 IYTNEVGNLWK*NVNQNFVPL*RHLATKHGGFSAVQKISM-LSGF 267 +YTN++G LW + N+ P R + GG + K+++ LS F Sbjct: 244 LYTNQMGFLWPLAIQMNYKPDSRVFTPRDGGHWTLAKLNLQLSDF 288 >SB_45576| Best HMM Match : LRR_1 (HMM E-Value=2.7e-14) Length = 829 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = -3 Query: 373 YGNETSTKISCHCDVIWPQNMAALVLYKRFQCYQVLSINVLAHFILNIVEYYLFVEF 203 + + +I+C+ D I +N Y RF CY VLS ++F + + YY+ + F Sbjct: 281 FHEQLKKQINCNTDHIIHEN------YSRFTCYNVLS----SYFSVTLCIYYILLVF 327 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,303,322 Number of Sequences: 59808 Number of extensions: 543183 Number of successful extensions: 945 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 945 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -