BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0431 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) 93 1e-19 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) 39 0.002 SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) 39 0.003 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 38 0.005 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 37 0.011 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.015 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 36 0.020 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 36 0.026 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 35 0.035 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 35 0.046 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 34 0.060 SB_23995| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-05) 34 0.060 SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) 34 0.060 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.060 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 34 0.080 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 34 0.080 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 34 0.080 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 34 0.080 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 34 0.080 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 34 0.080 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 34 0.080 SB_30622| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-14) 34 0.080 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 33 0.11 SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) 33 0.11 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 33 0.11 SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) 33 0.11 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 33 0.11 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) 33 0.14 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 33 0.14 SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 33 0.14 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 33 0.18 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 32 0.24 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 32 0.32 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 32 0.32 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 31 0.43 SB_9594| Best HMM Match : Extensin_2 (HMM E-Value=0.066) 31 0.43 SB_10020| Best HMM Match : Extensin_2 (HMM E-Value=0.88) 31 0.43 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 31 0.56 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 31 0.56 SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) 31 0.56 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 31 0.56 SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) 31 0.56 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 31 0.56 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 31 0.56 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) 31 0.74 SB_49453| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.98 SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) 30 0.98 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 30 0.98 SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) 30 1.3 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 29 1.7 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_55025| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_27781| Best HMM Match : Ank (HMM E-Value=0) 29 3.0 SB_23934| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) 29 3.0 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 29 3.0 SB_54954| Best HMM Match : zf-RanBP (HMM E-Value=2.1) 28 5.3 SB_47880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_44302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 28 5.3 SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) 28 5.3 SB_42153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_11722| Best HMM Match : Fer4 (HMM E-Value=0.25) 28 5.3 SB_2939| Best HMM Match : Ku (HMM E-Value=2.8e-07) 28 5.3 SB_43126| Best HMM Match : Myosin_head (HMM E-Value=4.1e-32) 27 6.9 SB_16291| Best HMM Match : F5_F8_type_C (HMM E-Value=1.6e-11) 27 6.9 SB_13493| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00046) 27 6.9 SB_20077| Best HMM Match : zf-RanBP (HMM E-Value=0.24) 27 6.9 SB_13055| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_9385| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_52669| Best HMM Match : zf-C3HC4 (HMM E-Value=0.05) 27 9.2 SB_27881| Best HMM Match : Keratin_B2 (HMM E-Value=0.5) 27 9.2 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 27 9.2 SB_48704| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_9266| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_650| Best HMM Match : rve (HMM E-Value=0.00048) 27 9.2 >SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) Length = 450 Score = 93.1 bits (221), Expect = 1e-19 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = +1 Query: 82 MPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTII 252 MPIQ PQWT++LTCP+C EF R PISL+CGHT+C+ CL LH+ QCPFDQ + Sbjct: 1 MPIQTPQWTEFLTCPICYHEFEDRQRGPISLACGHTICKACLSQLHKTQCPFDQATV 57 Score = 52.4 bits (120), Expect = 2e-07 Identities = 37/91 (40%), Positives = 49/91 (53%), Gaps = 10/91 (10%) Frame = +3 Query: 264 EELVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLK----CSG 431 ++L VNTALLQL Y P I + E+ + Y +R++EELA++LK G Sbjct: 62 DKLPVNTALLQLVVLGASVMDYPLPDIPNVRENSSK-YQAAMRSIEELAMYLKPVASSQG 120 Query: 432 NANMSGXXNRLS------RPMQRKLVTLLQC 506 + S N LS RPMQRKLVTL+ C Sbjct: 121 TSQSSNGTNGLSSSTTLTRPMQRKLVTLVNC 151 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 41.9 bits (94), Expect = 3e-04 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTIIQL 258 L CP+C R F + P+ SCGHT C+ C++ ++CP D + + Sbjct: 192 LFCPLCRRVF----KDPVITSCGHTFCQACIMARGVEKCPLDDNKLSI 235 >SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLI------HLHRKQCPFDQTII 252 D ++CP+C +F P P C H +CR CL+ L R +CP + I+ Sbjct: 21 DEISCPICYEDFEEPKCLP---KCAHNICRECLLGIIEKAQLERFECPICRAIV 71 >SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) Length = 843 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 115 LTCPVCCREFGA--PPRSPISLSCGHTLCRHCLIHLHRKQ 228 LTCP+C +G P R P L C HT C C++ + Q Sbjct: 328 LTCPLCYTAYGTGYPQRIPRILDCSHTFCTECIMKIKELQ 367 >SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D TC VC EF R P L C HTLC+ C+ Sbjct: 216 DECTCGVCQEEFNEKTRVPKLLHCSHTLCKACV 248 >SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) Length = 498 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D TC VC EF R P L C HTLC+ C+ Sbjct: 319 DECTCGVCQEEFNEKTRVPKLLHCSHTLCKACV 351 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 37.9 bits (84), Expect = 0.005 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQCPFDQTIIQLN 261 C +CCR F +P++ CGH CR CL HR CP ++ + N Sbjct: 379 CTLCCRLF----YNPVTTPCGHVFCRACLNRSLDHRPGCPICRSSLTQN 423 Score = 33.1 bits (72), Expect = 0.14 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQC 231 L+C CC P +L CGHT+C CL K+C Sbjct: 99 LSCVRCCGIL----LGPCTLPCGHTVCEKCLSKSQAKKC 133 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D L CP+C EF + P +LSC H LCR CL Sbjct: 17 DELLCPICLDEF----KEPKTLSCMHDLCRKCL 45 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 36.7 bits (81), Expect = 0.011 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQC 231 +TC +C ++ + P L+C HT CRHCL L H K+C Sbjct: 24 VTCSLCLEQY----QDPRVLACLHTYCRHCLESLVEHSKEC 60 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 36.3 bits (80), Expect = 0.015 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +1 Query: 97 PQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQC 231 P+ +TC +C ++ + P L+C HT CRHCL L H K+C Sbjct: 9 PKDVSDVTCSLCLGQY----QDPRVLACLHTYCRHCLESLVEHSKEC 51 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 35.9 bits (79), Expect = 0.020 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQC 231 +TC +C ++ + P L+C HT CRHCL L H K+C Sbjct: 14 VTCCLCLEQY----QDPRVLACLHTYCRHCLESLVEHSKEC 50 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 35.5 bits (78), Expect = 0.026 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 ++CPVC F P P SCGH++C CL ++ ++ P Sbjct: 21 ISCPVCLEVFEEPLVLP---SCGHSVCLQCLQNMTKRNPP 57 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 35.1 bits (77), Expect = 0.035 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +1 Query: 100 QWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 Q D +TC +C F P P C HT CRHCL Sbjct: 8 QLEDEVTCAICIEHFTDPRLLP----CLHTFCRHCL 39 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 34.7 bits (76), Expect = 0.046 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +1 Query: 76 IRMPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQCP 234 IR P + D C +C P++ CGH+ CR CL HR +CP Sbjct: 315 IRSPASNTEQLDDFECKLCFNLL----LEPVTSLCGHSFCRDCLYRSLDHRVECP 365 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 34.3 bits (75), Expect = 0.060 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 5/62 (8%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLS-CGHTLCRHCLIHLHRKQCPFD----QTIIQLNPRSWL*TR 285 CP+C F R PI + CGH C+ CL L R D + I+ L + W R Sbjct: 26 CPICQLAF----RDPIQIEECGHRFCQSCLQELRRLYVFVDKAARRAILGLGVKCWNWKR 81 Query: 286 RC 291 +C Sbjct: 82 KC 83 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 34.3 bits (75), Expect = 0.060 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 7/59 (11%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL----IHLHRK---QCPFDQTIIQLNP 264 D +TC +C F P P C H+ CRHCL +H K CP ++ Q++P Sbjct: 131 DEVTCSLCIEHFNDPRVLP----CLHSFCRHCLEELAVHSEGKGKLVCPLCKSEFQISP 185 >SB_23995| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-05) Length = 96 Score = 34.3 bits (75), Expect = 0.060 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK-----QCPFDQ 243 L CP+C E+ P R P C HT+C CL + K +CP D+ Sbjct: 20 LVCPICEEEYDDPKRLP----CMHTICLGCLESMVPKNALIMKCPIDE 63 >SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) Length = 589 Score = 34.3 bits (75), Expect = 0.060 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D +CPVC +F P P +C H +CR CL Sbjct: 19 DECSCPVCLEDFLEPKSLP---NCAHNVCRKCL 48 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 34.3 bits (75), Expect = 0.060 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL----IHLHRK---QCPFDQTIIQLNP 264 D +TC +C F P P C H+ CRHCL +H K CP + Q++P Sbjct: 11 DEVTCSLCIEHFNDPRVLP----CFHSFCRHCLEELAVHSEGKGKLVCPLCKAEFQISP 65 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 33.9 bits (74), Expect = 0.080 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 11 DEVTCSICIEHFNDPRVLP----CFHSFCRHCLEEL 42 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 33.9 bits (74), Expect = 0.080 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 11 DEVTCSICIEHFNDPRVLP----CFHSFCRHCLEEL 42 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 33.9 bits (74), Expect = 0.080 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 11 DEVTCSICIEHFNDPRVLP----CFHSFCRHCLEEL 42 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 33.9 bits (74), Expect = 0.080 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 11 DEVTCSICIEHFNDPRVLP----CFHSFCRHCLEEL 42 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 33.9 bits (74), Expect = 0.080 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 11 DEVTCSICIEHFNDPRVLP----CFHSFCRHCLEEL 42 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 33.9 bits (74), Expect = 0.080 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 10 DEVTCSICIEHFNDPRVLP----CFHSFCRHCLEEL 41 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 33.9 bits (74), Expect = 0.080 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTC VC +F R P L C HT C+ CL Sbjct: 20 LTCSVCLEQF----REPKMLPCFHTFCKECL 46 >SB_30622| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-14) Length = 856 Score = 33.9 bits (74), Expect = 0.080 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 5/37 (13%) Frame = +1 Query: 163 PISLSCGHTLCRHCLIHLHRKQ-----CPFDQTIIQL 258 P+ L CGHT C C+I L R Q CP Q + QL Sbjct: 405 PLLLECGHTYCDSCIIKLSRLQKTQVACPECQHVTQL 441 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 33.5 bits (73), Expect = 0.11 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 11 DEVTCSICIEHFNDPRVLP----CLHSFCRHCLEEL 42 >SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) Length = 787 Score = 33.5 bits (73), Expect = 0.11 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 5/97 (5%) Frame = +3 Query: 87 NSGASVDGLPNLSGVLPRVRCSAPESYQPQLR---PHPL*ALSDSPSSETMPLRPDDHTV 257 N ++ + + V P + PE P + P L + S ++++ + PD+ V Sbjct: 122 NEAPNIPTIEAVKPVEPEITSKPPEK-TPSVAIDMPQRLENTAPSETNDSDVVNPDNKPV 180 Query: 258 EPEELVVNTALLQLAGYAPPSQ--PYQPPCIKALPES 362 + +V++TA APPS+ +QPP K P S Sbjct: 181 KRNNIVLSTASWSRKTSAPPSEKNAFQPPMKKTKPSS 217 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 33.5 bits (73), Expect = 0.11 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 11 DEVTCSICIEHFNDPRVLP----CLHSFCRHCLEEL 42 >SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) Length = 576 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCL 207 CPVC F P P SC H +CR CL Sbjct: 22 CPVCIEVFEEPKSLP---SCAHNVCRECL 47 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 33.5 bits (73), Expect = 0.11 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 11 DEVTCSICIEHFNDPRVLP----CLHSFCRHCLEEL 42 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 33.5 bits (73), Expect = 0.11 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 10 DEVTCSICIEHFNDPRVLP----CLHSFCRHCLEEL 41 >SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) Length = 406 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCL 207 CPVC F P P SC H +CR CL Sbjct: 22 CPVCIEVFVEPKSLP---SCAHNVCRECL 47 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 97 PQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 P+ +TC +C ++ + P L+C HT CRHCL Sbjct: 9 PKDVSDVTCSLCLEQY----QDPRVLACLHTYCRHCL 41 >SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 103 WTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +++ LTCPVC E P SC H +C+ CL Sbjct: 11 FSEELTCPVCLEELKEP---KCLTSCAHNVCKPCL 42 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 33.1 bits (72), Expect = 0.14 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 16 DEVTCSICIEHFDDPRVLP----CLHSFCRHCLEEL 47 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 97 PQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 P+ +TC +C ++ + P L+C HT CRHCL Sbjct: 9 PKDVSDVTCSLCLEQY----QDPRVLACLHTYCRHCL 41 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 32.7 bits (71), Expect = 0.18 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 11 DEVTCSLCIEHFNDPRVLP----CLHSFCRHCLEEL 42 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 32.7 bits (71), Expect = 0.18 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ CRHCL L Sbjct: 11 DEVTCSLCIEHFNDPRVLP----CLHSFCRHCLEEL 42 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 32.7 bits (71), Expect = 0.18 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 7/55 (12%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK-------QCPFDQTIIQLNP 264 CP+C F + P L C HT C CL+ L + CP + ++Q++P Sbjct: 16 CPICLERF----KDPRVLPCLHTFCYECLVGLASRYKTEGKWPCPQCKMVVQVSP 66 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 32.7 bits (71), Expect = 0.18 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 7/55 (12%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK-------QCPFDQTIIQLNP 264 CP+C F + P L C HT C CL+ L + CP + ++Q++P Sbjct: 16 CPICLERF----KDPRVLPCLHTFCYECLVGLASRYKTEGKWPCPQCKMVVQVSP 66 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 32.3 bits (70), Expect = 0.24 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLS-CGHTLCRHCL 207 +CP+C EF P +P L CGH C CL Sbjct: 261 SCPICLEEF--TPETPTRLLVCGHKYCEPCL 289 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 31.9 bits (69), Expect = 0.32 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TC +C ++ + P L+C HT CRHCL Sbjct: 14 VTCCLCLEQY----QDPRVLACLHTYCRHCL 40 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 31.9 bits (69), Expect = 0.32 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 +TC +C F P P C H+ CRHCL L Sbjct: 13 VTCSICIEHFNDPRVLP----CLHSFCRHCLEEL 42 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 31.5 bits (68), Expect = 0.43 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D + C +C F P P C H+ CRHCL L Sbjct: 11 DEVRCSICIEHFNDPRVLP----CFHSFCRHCLEEL 42 >SB_9594| Best HMM Match : Extensin_2 (HMM E-Value=0.066) Length = 361 Score = 31.5 bits (68), Expect = 0.43 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRVQ 256 PP V C +P PT P + + TA + HSPP PC P V+ Sbjct: 47 PPNTVRPCHSP--PTAVHPCH-SPPTAVRPCHSPPTAVHPCHSPPNTVR 92 Score = 31.1 bits (67), Expect = 0.56 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRVQ 256 PP V C +P P P + + TA + HSPP PC P V+ Sbjct: 107 PPTAVHPCHSP--PNTVRPCH-SPPTAVRPCHSPPTAVRPCHSPPNTVR 152 Score = 31.1 bits (67), Expect = 0.56 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRVQ 256 PP V C +P PT P + + TA + HSPP PC P V+ Sbjct: 117 PPNTVRPCHSP--PTAVRPCH-SPPTAVRPCHSPPNTVRPCHSPPNTVR 162 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRVQ 256 PP V C +P PT P + +T + HSPP PC P V+ Sbjct: 127 PPTAVRPCHSP--PTAVRPCHSPPNTV-RPCHSPPNTVRPCHSPPNTVR 172 Score = 30.3 bits (65), Expect = 0.98 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQP 271 PP V C +P PT P + TA + HSPP PC P Sbjct: 207 PPNTVRPCHSP--PTAVHPCHSPL-TAVRPCHSPPNTVRPCHSP 247 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQP 271 PP V C +P P P + + TA + HSPP PC P Sbjct: 297 PPNTVRPCHSP--PNTVRPCH-SPPTAVRPCHSPPTAVRPCHSP 337 Score = 29.1 bits (62), Expect = 2.3 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRVQ 256 PP V C +P P P + TA HSPP PC P V+ Sbjct: 77 PPTAVHPCHSP--PNTVRPCHSPL-TAVHPCHSPPTAVHPCHSPPNTVR 122 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRV 259 PP V C +P P P + +T + HSPP PC P V Sbjct: 17 PPTAVHPCHSP--PNTVHPCHSPPNTV-RPCHSPPNTVRPCHSPPTAV 61 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRVQ 256 PP V C +P PT P + +T HSPP PC P V+ Sbjct: 7 PPNTVRPCHSP--PTAVHPCHSPPNTVHP-CHSPPNTVRPCHSPPNTVR 52 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQP 271 PP V C +P P P + +T + HSPP PC P Sbjct: 137 PPTAVRPCHSP--PNTVRPCHSPPNTV-RPCHSPPNTVRPCHSP 177 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRVQ 256 PP V C +P P P + + TA + HSPP PC P V+ Sbjct: 267 PPNTVRPCHSP--PNTVRPCH-SPPTAFRPCHSPPNTVRPCHSPPNTVR 312 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRVQ 256 PP C +P P P + +T + HSPP PC P V+ Sbjct: 287 PPTAFRPCHSP--PNTVRPCHSPPNTV-RPCHSPPTAVRPCHSPPTAVR 332 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/48 (35%), Positives = 20/48 (41%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRV 259 PP V C +P T P + TA + HSPP PC P V Sbjct: 177 PPNTVHPCHSPL--TAVHPCHSPL-TAVRPCHSPPNTVRPCHSPPTAV 221 Score = 27.1 bits (57), Expect = 9.2 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRV 259 PP V C +P P P + +T + HSPP PC P V Sbjct: 147 PPNTVRPCHSP--PNTVRPCHSPPNTV-RPCHSPPNTVHPCHSPLTAV 191 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = -1 Query: 402 PPWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPT 268 PP V C +P PT P + + TA + HSPP P PT Sbjct: 307 PPNTVRPCHSP--PTAVRPCH-SPPTAVRPCHSPPNTVHPLPFPT 348 >SB_10020| Best HMM Match : Extensin_2 (HMM E-Value=0.88) Length = 379 Score = 31.5 bits (68), Expect = 0.43 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 3/108 (2%) Frame = +3 Query: 42 SVIFVMSVRVIYKNANSGASVDGLPNL--SGVLPRVRCSAPESYQPQLRPHPL*ALSDSP 215 S+ V S+ ++ A LP + S L ++ S Y+P R PL + SP Sbjct: 202 SLSLVTSLSLVSLQAPPSYPYKPLPRILTSPSLVSLQASPSYPYKPLPRYKPLLRILTSP 261 Query: 216 SSETMPLRPDDHTVEPEELVVNTALLQLAGYAPPSQPYQP-PCIKALP 356 S ++ P ++ +P + ++ L L+ APPS PY+P P I P Sbjct: 262 SLVSLQA-PLSYSYKPLPRIPSSLCL-LSLQAPPSYPYKPLPRIPTSP 307 Score = 30.3 bits (65), Expect = 0.98 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 2/77 (2%) Frame = +3 Query: 111 LPNLSGVLPRVRCSAPESY--QPQLRPHPL*ALSDSPSSETMPLRPDDHTVEPEELVVNT 284 LP + V AP SY +P R PL + SPS ++ + P + +P + T Sbjct: 121 LPRIPTSPSLVSLQAPASYLYKPLPRYKPLPRIPTSPSLVSLQVSPS-YPYKPVSRIP-T 178 Query: 285 ALLQLAGYAPPSQPYQP 335 +L ++ APP PY+P Sbjct: 179 SLSLVSLQAPPLYPYKP 195 Score = 27.5 bits (58), Expect = 6.9 Identities = 31/101 (30%), Positives = 46/101 (45%), Gaps = 2/101 (1%) Frame = +3 Query: 60 SVRVIYKNANSGASVDGLPNLSGVLPRVRCSAPESYQPQLRPH-PL*ALSDSPSSETMPL 236 S ++ A+ S L +S L V AP SY PH PL + +S S ++ Sbjct: 12 SSALVSLQASPSYSYKPLLRISMSLSLVYLQAPPSY-----PHEPLPRIPESLSLVSLQA 66 Query: 237 RPDDHTVEPEELVVNTALLQLAGYAPPSQPYQP-PCIKALP 356 P + +P + T+L ++ APPS PY+P P I P Sbjct: 67 SPS-YPYKPLPRIP-TSLSLVSLQAPPSYPYKPLPRIHTSP 105 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 31.1 bits (67), Expect = 0.56 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C F P P C H+ C HCL L Sbjct: 11 DEVTCSICIEHFNDPRVLP----CFHSFCLHCLEEL 42 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 31.1 bits (67), Expect = 0.56 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 5/56 (8%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL-----HRKQCPFDQTIIQLNPR 267 L CP+C E A PR L C HT C+ CL +L H CP + + L R Sbjct: 143 LFCPLC-HEMFANPRL---LPCLHTFCKRCLENLVPPRSHTLSCPSCRLDVALGER 194 >SB_58465| Best HMM Match : zf-B_box (HMM E-Value=0.00022) Length = 476 Score = 31.1 bits (67), Expect = 0.56 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 115 LTCPVCCREFGAPPRS--PISLSCGHTLCRHCL 207 + C VC F A P +L+CGHT C CL Sbjct: 139 MCCSVCYNPFHATESQAIPRNLNCGHTYCTGCL 171 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 31.1 bits (67), Expect = 0.56 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHR--KQCP 234 D CP+C P CGHT CR C+ + K CP Sbjct: 674 DSAECPICLETITYPETLQ---GCGHTFCRPCITEASKSSKLCP 714 >SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) Length = 1387 Score = 31.1 bits (67), Expect = 0.56 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQ 228 CP+C R F +SP L C HT C C+ + R + Sbjct: 659 CPICSRPF----KSPKILPCLHTYCSDCVKEIVRSR 690 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 31.1 bits (67), Expect = 0.56 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHR--KQCP 234 D CP+C P CGHT CR C+ + K CP Sbjct: 749 DSAECPICLETITYPETLQ---GCGHTFCRPCITEASKSSKLCP 789 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 31.1 bits (67), Expect = 0.56 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D +TC +C P P C H+ CRHCL L Sbjct: 11 DEVTCSICIEHLNDPRVLP----CLHSFCRHCLEEL 42 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 30.7 bits (66), Expect = 0.74 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 + L CPVC E+ ++P+ L C H+ C C+ L Sbjct: 16 EQLMCPVCLGEY----KNPMLLRCYHSFCLRCVQEL 47 >SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) Length = 137 Score = 30.7 bits (66), Expect = 0.74 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 CPVC F +P + CGH LC+HC + R P Sbjct: 55 CPVCEDIFVSPVQIK---ECGHRLCQHCYKTIWRSPEP 89 >SB_49453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1117 Score = 30.7 bits (66), Expect = 0.74 Identities = 19/48 (39%), Positives = 22/48 (45%) Frame = +3 Query: 180 RPHPL*ALSDSPSSETMPLRPDDHTVEPEELVVNTALLQLAGYAPPSQ 323 R HP L+D T RP T PEE T + LA APP+Q Sbjct: 1012 RAHPK-LLTDHRQQRTTVTRPQLGTTHPEEATTATPGIPLAIAAPPAQ 1058 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 30.7 bits (66), Expect = 0.74 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIH 213 D C +C FG P+ +CGH C CL+H Sbjct: 53 DDFKCGIC---FGVL-EDPLVTTCGHVFCSQCLVH 83 >SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 30.3 bits (65), Expect = 0.98 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +2 Query: 383 CYTHHGGTCCILEMLRKRQYEWQXESTF 466 C+ H TC + EML++ Y++ +S F Sbjct: 165 CFQHKNHTCLVFEMLQQNLYDYLKQSKF 192 >SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) Length = 434 Score = 30.3 bits (65), Expect = 0.98 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISL-SCGHTLCRHC 204 CP+C +P++L CGHT C+ C Sbjct: 235 CPLCQTLMSGSRHTPVALIPCGHTFCQMC 263 >SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) Length = 892 Score = 30.3 bits (65), Expect = 0.98 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 94 APQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHC 204 AP W + C +C +FG R +CG C+ C Sbjct: 224 APAWAEGDVCHMCRVKFGTFIRQHHCRNCGQVFCKKC 260 >SB_4835| Best HMM Match : WWE (HMM E-Value=3.7e-19) Length = 320 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCL--IHLHRKQC 231 CPVC ++ P R P CGH C C+ + L ++C Sbjct: 71 CPVCLQQASYPVRLP----CGHMFCFLCIKGVALRSRKC 105 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 79 RMPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 R P+Q D L C P P L C HT C CL Sbjct: 80 RSPLQMASILDSLRQEAECSLCHKTPSEPKILKCFHTFCNECL 122 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 29.5 bits (63), Expect = 1.7 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQ--CPFDQTIIQLNP 264 D +C VC F +L+C H+ C +CL RK+ CP + +Q P Sbjct: 367 DEFSCIVCQELF----IRATTLTCSHSFCEYCLQSWLRKRNTCPICRCAVQSQP 416 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 88 IQAPQWTDYLTCPVCCREFGAPPRSPISL---SCGHTLCRHCLIHLHR 222 IQ + D + CP C G PR + +C +CR C I+ HR Sbjct: 137 IQENEVKDSIQCPSFC---GMHPREVLKYFCETCDQAICRDCAIYEHR 181 >SB_55025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2468 Score = 28.7 bits (61), Expect = 3.0 Identities = 28/112 (25%), Positives = 46/112 (41%) Frame = +3 Query: 87 NSGASVDGLPNLSGVLPRVRCSAPESYQPQLRPHPL*ALSDSPSSETMPLRPDDHTVEPE 266 N+ ++DG+P GV P + PE+ + ++ L L PSS + D V + Sbjct: 846 NNSLTIDGIPIPEGVDPSFLEALPEALRREVLSEQL-GLRPPPSSGSAATSADGGVVSQD 904 Query: 267 ELVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLK 422 L V+ L PP + + L E R+A + T + FL+ Sbjct: 905 PLNVSPEFL---AALPPDVQEEVLQQQRLEEERRRAQQSQPDTPVDPGAFLR 953 >SB_27781| Best HMM Match : Ank (HMM E-Value=0) Length = 485 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +1 Query: 97 PQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHC 204 P W+D +C C +F R CG LC C Sbjct: 421 PPWSDGDSCHECGMKFSIKNRKHHCRHCGRLLCAKC 456 >SB_23934| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-07) Length = 617 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCL 207 C +C EF P + + L CGH+ +HC+ Sbjct: 560 CVICLDEF-KPGCTLLGLPCGHSFHQHCI 587 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL-HRKQCP 234 D CP C E P + +CGH CR C+ +L KQ P Sbjct: 1947 DQELCPACFCEVDNPYQLA---TCGHVYCRGCVTNLIEAKQFP 1986 >SB_54954| Best HMM Match : zf-RanBP (HMM E-Value=2.1) Length = 172 Score = 27.9 bits (59), Expect = 5.3 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -1 Query: 384 QCRTPACPTP--GEP*YKAADTAAKVAHSPPAEAAPCSQPTP 265 Q +TPA TP G P TAA A +PP AAP + P Sbjct: 112 QRKTPAATTPPTGAPAATTPPTAAPAATTPPT-AAPAATTPP 152 >SB_47880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 27.9 bits (59), Expect = 5.3 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -1 Query: 384 QCRTPACPTP--GEP*YKAADTAAKVAHSPPAEAAPCSQPTP 265 Q +TPA TP G P TAA A +PP AAP + P Sbjct: 179 QRKTPAATTPPTGAPAATTPPTAAPAATTPPT-AAPAATTPP 219 >SB_44302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 27.9 bits (59), Expect = 5.3 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -1 Query: 384 QCRTPACPTP--GEP*YKAADTAAKVAHSPPAEAAPCSQPTP 265 Q +TPA TP G P TAA A +PP AAP + P Sbjct: 2 QRKTPAATTPPTGAPAATTPPTAAPAATTPPT-AAPAATTPP 42 >SB_41147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 DY CP+C F P ++ CGH C CL + R+ Sbjct: 39 DY-QCPICQLPFRDPVQTR---DCGHRFCESCLEPILRR 73 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 131 AAESSVLRPGVLSASAAATPSVGTV*FTFIGNNAPSTRRSYS 256 AA S+ R VLS+ +A PS GTV ++ T +Y+ Sbjct: 635 AAAGSLYRNSVLSSYGSAAPSYGTVPASYASATGSYTASAYT 676 >SB_1004| Best HMM Match : CPSase_sm_chain (HMM E-Value=0) Length = 2007 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 114 PNLSGVLPRVRCSAPESYQPQLRPH 188 PNL ++ V C P Y PQ PH Sbjct: 526 PNLENLVDIVSCKIPTVYNPQGTPH 550 >SB_42153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 5.3 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -1 Query: 384 QCRTPACPTP--GEP*YKAADTAAKVAHSPPAEAAPCSQPTP 265 Q +TPA TP G P TAA A +PP AAP + P Sbjct: 65 QRKTPAATTPPTGAPAATTPPTAAPAATTPPT-AAPAATTPP 105 >SB_11722| Best HMM Match : Fer4 (HMM E-Value=0.25) Length = 401 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 266 GVGCEHGAASAGGLCATFAAVSAALYQGSPGVGQAGVRHCYTH-HG 400 G GC+H A C+ + A+ + G G G H + H HG Sbjct: 88 GPGCQHAARFGSKYCSDECGIQLAVRKNDVGDGVHGHGHGHGHGHG 133 >SB_2939| Best HMM Match : Ku (HMM E-Value=2.8e-07) Length = 512 Score = 27.9 bits (59), Expect = 5.3 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 Query: 251 YS*TRGVGCEHGAASAGGLCATFAAVSAALYQGSPGVG 364 YS G C HG S+ G A VS +YQ S G G Sbjct: 345 YSSGCGDPCGHGKGSSSGAAIRLAFVSHYIYQRSLGDG 382 >SB_43126| Best HMM Match : Myosin_head (HMM E-Value=4.1e-32) Length = 898 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = -1 Query: 207 QTVPTEGVAAAEADRTPGRSTELSAAHRTG*VVRPLRRLNW 85 Q +PT ++A + TP +T +S R+G +VRP RLN+ Sbjct: 537 QPLPT--ISANQESSTPA-NTRVSQTTRSGRIVRPPTRLNF 574 >SB_16291| Best HMM Match : F5_F8_type_C (HMM E-Value=1.6e-11) Length = 423 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = -2 Query: 167 IGLRGGAPNSRQHTGQVR*SVH*GA*IGILINNTYTHHKNNTLYFYP 27 + +G AP+SRQHT Q S G + ++N ++ +N T+ +P Sbjct: 336 VATQGRAPDSRQHTHQYVTSY--GLDYSLDVSNWESYKENGTVKIFP 380 >SB_13493| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00046) Length = 488 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 + C +C E + + L CGH C++ L CP Sbjct: 288 ILCSICLEE--VQKETSVELECGHGNHLKCVLRLRSATCP 325 >SB_20077| Best HMM Match : zf-RanBP (HMM E-Value=0.24) Length = 346 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 384 QCRTPACPTP--GEP*YKAADTAAKVAHSPPAEAAPCSQP 271 Q +TPA TP G P TAA A +PP A + P Sbjct: 287 QRKTPAATTPPTGSPAATTPPTAAPAATTPPTVAPAATTP 326 >SB_13055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1140 Score = 27.5 bits (58), Expect = 6.9 Identities = 21/96 (21%), Positives = 40/96 (41%), Gaps = 4/96 (4%) Frame = +3 Query: 138 RVRCSAPESYQPQLRPHPL*ALSDSPSSETMPLRPDDHTVEPEELVVNTALLQLAGYAPP 317 R R S S PQ +P P+ + ++ P P E EE + + + P Sbjct: 283 RSRRSKDRSRSPQRKPSPVARATVGETTSAKPTTPPGSPREEEEAADQSDVRSDDLFEPL 342 Query: 318 SQPYQPPCIKALPESD----RQAYDTVIRTMEELAV 413 + + P + E+D + AY+ ++ EE+++ Sbjct: 343 TPDHSPTDLFMSDEADDDDEQDAYEEILSDEEEMSL 378 >SB_9385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHC 204 CP+C ++F R CG LC C Sbjct: 48 CPLCSQKFTQIRRKHHCRQCGRVLCNKC 75 >SB_52669| Best HMM Match : zf-C3HC4 (HMM E-Value=0.05) Length = 280 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 166 ISLSCGHTLCRHCLIHLHRKQCP 234 + L+CGH+ R C HRK CP Sbjct: 188 VLLTCGHSFHREC----HRKTCP 206 >SB_27881| Best HMM Match : Keratin_B2 (HMM E-Value=0.5) Length = 168 Score = 27.1 bits (57), Expect = 9.2 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 2/62 (3%) Frame = +3 Query: 165 YQPQLRPHPL*ALSDSPSSETMPLRPDDHTVEPEELVVNTALLQLAGYAPPSQ--PYQPP 338 YQP HP+ + P P+ + V+T L Q + P PYQPP Sbjct: 86 YQPSCINHPVSTIMYQPPCINHPVSTTLYQPSCINHPVSTILYQPSCINHPVSTIPYQPP 145 Query: 339 CI 344 CI Sbjct: 146 CI 147 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 L C VC + F P L C H+ C+ C+ L RK Sbjct: 60 LICRVCNQRFNKPKL----LHCLHSFCQSCIEGLARK 92 >SB_48704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 166 ISLSCGHTLCRHCLIHLHRKQCP 234 + L+CGH+ R C HRK CP Sbjct: 516 VLLTCGHSFHREC----HRKTCP 534 >SB_9266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1490 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 166 ISLSCGHTLCRHCLIHLHRKQCP 234 + L+CGH+ R C HRK CP Sbjct: 636 VLLTCGHSFHREC----HRKTCP 654 >SB_650| Best HMM Match : rve (HMM E-Value=0.00048) Length = 363 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 234 LRPDDHTVEPEELVV--NTALLQLAGYAPPSQPYQPPCIKALPESDRQA 374 LRP + T+ E+ N L Y PP+Q Y PC +AL + + QA Sbjct: 234 LRPVEVTIGMEKFTNPRNIQLTSTTTYVPPNQVY-VPCSQALYKPEVQA 281 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,733,560 Number of Sequences: 59808 Number of extensions: 372940 Number of successful extensions: 1240 Number of sequences better than 10.0: 91 Number of HSP's better than 10.0 without gapping: 1034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1219 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -