BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0431 (516 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL136170-1|CAI19418.1| 1133|Homo sapiens ring finger and CCCH-ty... 95 1e-19 AL121983-1|CAI12318.1| 1133|Homo sapiens ring finger and CCCH-ty... 95 1e-19 BC044642-1|AAH44642.1| 506|Homo sapiens RC3H2 protein protein. 87 3e-17 AL359512-8|CAI94964.1| 1191|Homo sapiens ring finger and CCCH-ty... 87 3e-17 AF255303-1|AAG00432.1| 1048|Homo sapiens membrane-associated nuc... 87 3e-17 AB095945-1|BAC23121.1| 1109|Homo sapiens KIAA2025 protein protein. 58 2e-08 AL136170-3|CAI19419.1| 1086|Homo sapiens ring finger and CCCH-ty... 54 4e-07 AL136170-2|CAI19417.1| 1094|Homo sapiens ring finger and CCCH-ty... 54 4e-07 AL121983-3|CAH70710.1| 1086|Homo sapiens ring finger and CCCH-ty... 54 4e-07 AL121983-2|CAH70709.1| 1094|Homo sapiens ring finger and CCCH-ty... 54 4e-07 BC011688-1|AAH11688.2| 177|Homo sapiens Unknown (protein for IM... 49 1e-05 BC112154-1|AAI12155.1| 487|Homo sapiens tripartite motif protei... 42 0.001 BC112152-1|AAI12153.1| 487|Homo sapiens tripartite motif protei... 42 0.001 BC003154-1|AAH03154.1| 653|Homo sapiens tripartite motif-contai... 42 0.001 AL133284-7|CAB92723.1| 653|Homo sapiens tripartite motif-contai... 42 0.001 AL133284-6|CAI16372.1| 173|Homo sapiens tripartite motif-contai... 42 0.001 BC025949-1|AAH25949.1| 294|Homo sapiens TRIM4 protein protein. 41 0.003 BC011763-1|AAH11763.1| 294|Homo sapiens TRIM4 protein protein. 41 0.003 AF220024-1|AAG53478.1| 474|Homo sapiens tripartite motif protei... 41 0.003 AF220023-1|AAG53477.1| 500|Homo sapiens tripartite motif protei... 41 0.003 AC011904-3|AAS07396.1| 294|Homo sapiens unknown protein. 41 0.003 AC011904-2|AAS07398.1| 474|Homo sapiens unknown protein. 41 0.003 AC011904-1|AAS07397.1| 500|Homo sapiens unknown protein. 41 0.003 AY081949-1|AAL91072.1| 486|Homo sapiens tripartite motif protei... 40 0.004 AY081948-1|AAL91071.1| 487|Homo sapiens tripartite motif protei... 40 0.004 U18543-1|AAA86474.1| 653|Homo sapiens zinc-finger protein protein. 40 0.007 BC024267-1|AAH24267.1| 594|Homo sapiens TRAF7 protein protein. 40 0.007 AY569455-1|AAS68363.1| 670|Homo sapiens TRAF7 protein. 40 0.007 DQ301480-1|ABC01033.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301479-1|ABC01032.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301478-1|ABC01031.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301477-1|ABC01030.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301475-1|ABC01028.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301474-1|ABC01027.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301473-1|ABC01026.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301472-1|ABC01025.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301471-1|ABC01024.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301470-1|ABC01023.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301469-1|ABC01022.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301464-1|ABC01017.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301462-1|ABC01015.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301457-1|ABC01010.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301455-1|ABC01008.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301454-1|ABC01007.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301453-1|ABC01006.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301451-1|ABC01004.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301450-1|ABC01003.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301449-1|ABC01002.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301448-1|ABC01001.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301447-1|ABC01000.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301446-1|ABC00999.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301445-1|ABC00998.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ301444-1|ABC00997.1| 493|Homo sapiens TRIM5 protein. 38 0.028 DQ288685-1|ABB90543.1| 493|Homo sapiens TRIM5alpha protein. 38 0.028 BX255925-1|CAM24146.1| 261|Homo sapiens novel protein (DKFZp761... 38 0.028 BC090061-1|AAH90061.1| 180|Homo sapiens hypothetical protein LO... 38 0.028 BC021258-1|AAH21258.1| 347|Homo sapiens tripartite motif-contai... 38 0.028 BC020770-1|AAH20770.1| 219|Homo sapiens Unknown (protein for IM... 38 0.028 BC016958-1|AAH16958.1| 180|Homo sapiens RNF208 protein protein. 38 0.028 BC007372-1|AAH07372.1| 297|Homo sapiens tripartite motif-contai... 38 0.028 AY625000-1|AAT48101.1| 493|Homo sapiens TRIM5 alpha protein. 38 0.028 AK054802-1|BAB70809.1| 297|Homo sapiens protein ( Homo sapiens ... 38 0.028 AK027593-1|BAB55218.1| 493|Homo sapiens protein ( Homo sapiens ... 38 0.028 AF498999-1|AAP30736.1| 250|Homo sapiens tripartite motif protei... 38 0.028 AF416715-1|AAL16809.1| 180|Homo sapiens unknown protein. 38 0.028 AF220029-1|AAG53483.1| 271|Homo sapiens tripartite motif protei... 38 0.028 AF220028-1|AAG53482.1| 326|Homo sapiens tripartite motif protei... 38 0.028 AF220027-1|AAG53481.1| 347|Homo sapiens tripartite motif protei... 38 0.028 AF220026-1|AAG53480.1| 400|Homo sapiens tripartite motif protei... 38 0.028 AF220025-1|AAG53479.1| 493|Homo sapiens tripartite motif protei... 38 0.028 AB209243-1|BAD92480.1| 311|Homo sapiens tripartite motif-contai... 38 0.028 L04510-1|AAA35940.1| 574|Homo sapiens nucleotide binding protei... 37 0.036 BC103890-1|AAI03891.1| 395|Homo sapiens NHL repeat containing 1... 37 0.036 BC103889-1|AAI03890.1| 395|Homo sapiens NHL repeat containing 1... 37 0.036 BC103888-1|AAI03889.1| 395|Homo sapiens NHL repeat containing 1... 37 0.036 BC022510-1|AAH22510.1| 574|Homo sapiens tripartite motif-contai... 37 0.036 AY324850-1|AAQ19671.1| 395|Homo sapiens malin protein. 37 0.036 AL589723-1|CAH71232.1| 395|Homo sapiens protein ( Human DNA seq... 37 0.036 AF230399-1|AAG50178.1| 546|Homo sapiens tripartite motif protei... 37 0.036 AF230398-1|AAG50177.1| 569|Homo sapiens tripartite motif protei... 37 0.036 AF230397-1|AAG50176.1| 574|Homo sapiens tripartite motif protei... 37 0.036 AK027876-1|BAB55424.1| 488|Homo sapiens protein ( Homo sapiens ... 36 0.064 AF220143-1|AAG53516.1| 488|Homo sapiens tripartite motif protei... 36 0.064 AB039904-1|BAB17051.1| 270|Homo sapiens interferon-responsive f... 36 0.064 AB039903-1|BAB17050.1| 842|Homo sapiens interferon-responsive f... 36 0.064 AB039902-1|BAB17049.1| 488|Homo sapiens interferon-responsive f... 36 0.064 BC033871-1|AAH33871.1| 249|Homo sapiens TRIM74 protein protein. 36 0.084 BC033211-1|AAH33211.1| 269|Homo sapiens TRIM72 protein protein. 36 0.084 AK131485-1|BAD18630.1| 477|Homo sapiens protein ( Homo sapiens ... 36 0.084 AF498998-1|AAP30735.1| 250|Homo sapiens tripartite motif protei... 36 0.084 U13658-1|AAA79867.1| 475|Homo sapiens RO52 protein. 36 0.11 U01882-1|AAB87094.1| 475|Homo sapiens 52 kda component of SS-A/... 36 0.11 M62800-1|AAA36651.1| 475|Homo sapiens 52-kD SS-A/Ro autoantigen... 36 0.11 M34551-1|AAA36581.1| 475|Homo sapiens protein ( Human 52-kD rib... 36 0.11 BC048194-1|AAH48194.1| 755|Homo sapiens tripartite motif-contai... 36 0.11 BC013036-1|AAH13036.1| 192|Homo sapiens ring finger protein 183... 36 0.11 BC011882-1|AAH11882.1| 379|Homo sapiens TRIM56 protein protein. 36 0.11 BC010861-1|AAH10861.1| 475|Homo sapiens tripartite motif-contai... 36 0.11 BC005847-1|AAH05847.3| 755|Homo sapiens tripartite motif-contai... 36 0.11 BC001862-1|AAH01862.1| 208|Homo sapiens tripartite motif-contai... 36 0.11 AY742713-1|AAU89982.1| 475|Homo sapiens Sjogren syndrome antige... 36 0.11 AK092927-1|BAC04004.1| 269|Homo sapiens protein ( Homo sapiens ... 36 0.11 AF521869-1|AAO14946.1| 375|Homo sapiens tripartite motif protei... 36 0.11 AF391283-1|AAK76432.1| 475|Homo sapiens SSA1 protein. 36 0.11 D87458-1|BAA13398.2| 711|Homo sapiens KIAA0282 protein. 35 0.15 DQ301458-1|ABC01011.1| 493|Homo sapiens TRIM5 protein. 35 0.15 DQ301456-1|ABC01009.1| 493|Homo sapiens TRIM5 protein. 35 0.15 BC132867-1|AAI32868.1| 511|Homo sapiens tripartite motif-contai... 35 0.15 BC132863-1|AAI32864.1| 511|Homo sapiens tripartite motif-contai... 35 0.15 BC080553-1|AAH80553.1| 221|Homo sapiens tripartite motif-contai... 35 0.15 BC011567-1|AAH11567.1| 221|Homo sapiens tripartite motif-contai... 35 0.15 AF396651-1|AAK85377.1| 511|Homo sapiens glycogenin-interacting ... 35 0.15 AF220032-1|AAG53486.1| 221|Homo sapiens tripartite motif protei... 35 0.15 Y07829-1|CAB52384.1| 481|Homo sapiens RING finger protein protein. 35 0.19 BX005441-5|CAM26238.1| 481|Homo sapiens tripartite motif-contai... 35 0.19 BX005441-4|CAM26237.1| 395|Homo sapiens tripartite motif-contai... 35 0.19 BC126472-1|AAI26473.1| 452|Homo sapiens tripartite motif-contai... 35 0.19 BC126470-1|AAI26471.1| 452|Homo sapiens tripartite motif-contai... 35 0.19 BC113419-1|AAI13420.1| 395|Homo sapiens tripartite motif-contai... 35 0.19 BC093926-1|AAH93926.1| 395|Homo sapiens tripartite motif-contai... 35 0.19 BC075020-1|AAH75020.1| 452|Homo sapiens ring finger protein 18 ... 35 0.19 BC075019-1|AAH75019.1| 452|Homo sapiens tripartite motif-contai... 35 0.19 BA000025-88|BAB63332.1| 481|Homo sapiens RNF9 protein. 35 0.19 AL844220-2|CAI18610.1| 481|Homo sapiens tripartite motif-contai... 35 0.19 AL844220-1|CAI18609.1| 395|Homo sapiens tripartite motif-contai... 35 0.19 AL671859-11|CAI17587.1| 481|Homo sapiens tripartite motif-conta... 35 0.19 AL671859-10|CAI17586.1| 395|Homo sapiens tripartite motif-conta... 35 0.19 AL669914-11|CAI18188.1| 481|Homo sapiens tripartite motif-conta... 35 0.19 AL669914-10|CAI18187.1| 395|Homo sapiens tripartite motif-conta... 35 0.19 AF220123-1|AAG53496.1| 396|Homo sapiens tripartite motif protei... 35 0.19 AF220122-1|AAG53495.1| 482|Homo sapiens tripartite motif protei... 35 0.19 AB202085-1|BAE78605.1| 481|Homo sapiens tripartite motif-contai... 35 0.19 AB103595-1|BAF31256.1| 481|Homo sapiens Zn-finger protein protein. 35 0.19 AB088089-1|BAC54921.1| 481|Homo sapiens tripartite motif-contai... 35 0.19 AB037682-1|BAB03503.1| 452|Homo sapiens testis-specific RING Fi... 35 0.19 Y13667-1|CAA74018.1| 667|Homo sapiens putative transcription fa... 34 0.26 DQ232883-1|ABB18376.1| 500|Homo sapiens tripartite motif protei... 34 0.26 BX537987-1|CAD97947.1| 323|Homo sapiens hypothetical protein pr... 34 0.26 BC111956-1|AAI11957.1| 203|Homo sapiens ring finger protein 152... 34 0.26 BC109260-1|AAI09261.1| 403|Homo sapiens tripartite motif-contai... 34 0.26 BC109259-1|AAI09260.1| 403|Homo sapiens tripartite motif-contai... 34 0.26 BC094004-1|AAH94004.1| 203|Homo sapiens ring finger protein 152... 34 0.26 BC063407-1|AAH63407.1| 407|Homo sapiens tripartite motif-contai... 34 0.26 BC053671-1|AAH53671.1| 1056|Homo sapiens SH3RF1 protein protein. 34 0.26 BC053626-1|AAH53626.1| 667|Homo sapiens midline 1 (Opitz/BBB sy... 34 0.26 BC047945-1|AAH47945.1| 500|Homo sapiens tripartite motif-contai... 34 0.26 BC024199-1|AAH24199.1| 503|Homo sapiens TRIM69 protein protein. 34 0.26 BC003579-1|AAH03579.1| 407|Homo sapiens tripartite motif-contai... 34 0.26 AY764035-1|AAV51406.1| 410|Homo sapiens candidate tumor suppres... 34 0.26 AY455758-1|AAR31110.1| 407|Homo sapiens leu5 protein. 34 0.26 AY191002-1|AAO38979.1| 407|Homo sapiens ret finger protein 2 tr... 34 0.26 AY159379-1|AAN86853.1| 403|Homo sapiens tumor suppressor TSBF1 ... 34 0.26 AY026763-1|AAK07687.1| 638|Homo sapiens gene overexpressed in a... 34 0.26 AL137060-3|CAC43391.1| 407|Homo sapiens tripartite motif-contai... 34 0.26 AL137060-2|CAH72826.1| 266|Homo sapiens tripartite motif-contai... 34 0.26 AL137060-1|CAH72825.1| 129|Homo sapiens tripartite motif-contai... 34 0.26 AK096495-1|BAC04805.1| 203|Homo sapiens protein ( Homo sapiens ... 34 0.26 AK021429-1|BAB13822.1| 712|Homo sapiens protein ( Homo sapiens ... 34 0.26 AJ224819-1|CAA12136.1| 407|Homo sapiens tumor suppressor protein. 34 0.26 AF279660-1|AAK13059.1| 407|Homo sapiens CAR protein. 34 0.26 AF269101-1|AAG33130.1| 667|Homo sapiens midline 1 protein. 34 0.26 AF241850-1|AAF91315.1| 407|Homo sapiens ret finger protein 2 pr... 34 0.26 AF241849-2|ABE41638.1| 407|Homo sapiens putative tumor suppress... 34 0.26 AF241849-1|AAK51624.1| 407|Homo sapiens putative tumor suppress... 34 0.26 AF230977-1|AAG50192.1| 552|Homo sapiens tripartite motif protei... 34 0.26 AF230976-1|AAG50191.1| 667|Homo sapiens tripartite motif protei... 34 0.26 AF220128-1|AAG53501.1| 175|Homo sapiens tripartite motif protei... 34 0.26 AF220127-1|AAG53500.1| 407|Homo sapiens tripartite motif protei... 34 0.26 AF041209-1|AAC33001.1| 667|Homo sapiens midline 1 fetal kidney ... 34 0.26 AF041208-1|AAC33000.1| 667|Homo sapiens midline 1 fetal kidney ... 34 0.26 AF041207-1|AAC32999.1| 228|Homo sapiens midline 1 cerebellar is... 34 0.26 AF041206-1|AAC32998.1| 484|Homo sapiens midline 1 cerebellar is... 34 0.26 AF035360-1|AAB99951.1| 667|Homo sapiens ring finger protein pro... 34 0.26 Z84476-1|CAI19959.1| 513|Homo sapiens ret finger protein protein. 34 0.34 Z84474-1|CAB06480.2| 513|Homo sapiens ret finger protein protein. 34 0.34 M16029-1|AAA36786.1| 805|Homo sapiens protein ( Human ret mRNA ... 34 0.34 J03407-1|AAA36564.1| 513|Homo sapiens protein ( Human rfp trans... 34 0.34 DQ301476-1|ABC01029.1| 493|Homo sapiens TRIM5 protein. 34 0.34 DQ301468-1|ABC01021.1| 493|Homo sapiens TRIM5 protein. 34 0.34 DQ301467-1|ABC01020.1| 493|Homo sapiens TRIM5 protein. 34 0.34 DQ301466-1|ABC01019.1| 493|Homo sapiens TRIM5 protein. 34 0.34 DQ301465-1|ABC01018.1| 493|Homo sapiens TRIM5 protein. 34 0.34 DQ301463-1|ABC01016.1| 493|Homo sapiens TRIM5 protein. 34 0.34 DQ301461-1|ABC01014.1| 493|Homo sapiens TRIM5 protein. 34 0.34 DQ301460-1|ABC01013.1| 493|Homo sapiens TRIM5 protein. 34 0.34 DQ301459-1|ABC01012.1| 493|Homo sapiens TRIM5 protein. 34 0.34 DQ301452-1|ABC01005.1| 493|Homo sapiens TRIM5 protein. 34 0.34 BX537153-2|CAI18646.1| 513|Homo sapiens tripartite motif-contai... 34 0.34 BX537153-1|CAI18645.1| 358|Homo sapiens tripartite motif-contai... 34 0.34 BX119924-2|CAM26231.1| 513|Homo sapiens ret finger protein prot... 34 0.34 BX119924-1|CAM26230.1| 358|Homo sapiens ret finger protein prot... 34 0.34 BX005144-2|CAM25872.1| 513|Homo sapiens ret finger protein prot... 34 0.34 BX005144-1|CAM25871.1| 358|Homo sapiens ret finger protein prot... 34 0.34 BX000360-2|CAI18619.1| 513|Homo sapiens tripartite motif-contai... 34 0.34 BX000360-1|CAI18618.1| 358|Homo sapiens tripartite motif-contai... 34 0.34 BC103491-1|AAI03492.1| 718|Homo sapiens LON peptidase N-termina... 34 0.34 BC100986-1|AAI00987.1| 471|Homo sapiens TRIM60 protein protein. 34 0.34 BC100985-1|AAI00986.1| 471|Homo sapiens tripartite motif-contai... 34 0.34 BC100984-1|AAI00985.1| 471|Homo sapiens tripartite motif-contai... 34 0.34 BC100983-1|AAI00984.1| 471|Homo sapiens tripartite motif-contai... 34 0.34 BC100671-1|AAI00672.1| 759|Homo sapiens LON peptidase N-termina... 34 0.34 BC099847-1|AAH99847.1| 759|Homo sapiens LON peptidase N-termina... 34 0.34 BC066924-1|AAH66924.1| 513|Homo sapiens tripartite motif-contai... 34 0.34 BC013580-1|AAH13580.1| 513|Homo sapiens tripartite motif-contai... 34 0.34 AL772284-3|CAI41520.1| 524|Homo sapiens LON peptidase N-termina... 34 0.34 AL772284-2|CAI41519.1| 718|Homo sapiens LON peptidase N-termina... 34 0.34 AL662871-4|CAI18381.1| 513|Homo sapiens tripartite motif-contai... 34 0.34 AL662871-3|CAM25659.1| 358|Homo sapiens tripartite motif-contai... 34 0.34 AL662859-4|CAI17553.1| 513|Homo sapiens tripartite motif-contai... 34 0.34 AL662859-3|CAM24901.1| 358|Homo sapiens tripartite motif-contai... 34 0.34 AK131543-1|BAD18678.1| 205|Homo sapiens protein ( Homo sapiens ... 34 0.34 AK093201-1|BAC04093.1| 471|Homo sapiens protein ( Homo sapiens ... 34 0.34 AK091777-1|BAC03744.1| 610|Homo sapiens protein ( Homo sapiens ... 34 0.34 AK026265-1|BAB15419.1| 516|Homo sapiens protein ( Homo sapiens ... 34 0.34 AF230394-1|AAG50173.1| 358|Homo sapiens tripartite motif protei... 34 0.34 AF230393-1|AAG50172.1| 513|Homo sapiens tripartite motif protei... 34 0.34 AF171101-1|AAF32265.1| 47|Homo sapiens RFP transforming protei... 34 0.34 AB209885-1|BAD93122.1| 382|Homo sapiens ret finger protein isof... 34 0.34 BC050030-1|AAH50030.1| 247|Homo sapiens RNF182 protein protein. 33 0.45 BC036755-1|AAH36755.1| 690|Homo sapiens ligand of numb-protein ... 33 0.45 BC030666-1|AAH30666.1| 247|Homo sapiens ring finger protein 182... 33 0.45 AL138699-1|CAH73446.1| 690|Homo sapiens ligand of numb-protein ... 33 0.45 AK090576-1|BAC03481.1| 247|Homo sapiens protein ( Homo sapiens ... 33 0.45 Y18880-1|CAB56154.1| 715|Homo sapiens midline 2 protein protein. 33 0.59 X82200-1|CAA57684.1| 442|Homo sapiens gpStaf50 protein. 33 0.59 BT006663-1|AAP35309.1| 685|Homo sapiens midline 2 protein. 33 0.59 BC089393-1|AAH89393.1| 209|Homo sapiens tripartite motif-contai... 33 0.59 BC035582-1|AAH35582.1| 498|Homo sapiens tripartite motif-contai... 33 0.59 BC022281-1|AAH22281.1| 498|Homo sapiens tripartite motif-contai... 33 0.59 BC017707-1|AAH17707.1| 685|Homo sapiens midline 2 protein. 33 0.59 BC003054-1|AAH03054.1| 450|Homo sapiens bifunctional apoptosis ... 33 0.59 AY625004-1|AAT48105.1| 685|Homo sapiens TRIM1 beta protein. 33 0.59 AL109946-4|CAO72054.1| 685|Homo sapiens midline 2 protein. 33 0.59 AL109946-3|CAO72053.1| 715|Homo sapiens midline 2 protein. 33 0.59 AL109946-2|CAO72052.1| 219|Homo sapiens midline 2 protein. 33 0.59 AL034399-3|CAI42074.1| 685|Homo sapiens midline 2 protein. 33 0.59 AL034399-2|CAI42073.1| 715|Homo sapiens midline 2 protein. 33 0.59 AF196481-1|AAF07341.1| 685|Homo sapiens RING finger protein pro... 33 0.59 AF173003-1|AAF59975.1| 450|Homo sapiens apoptosis regulator pro... 33 0.59 Y07828-1|CAA69165.1| 236|Homo sapiens put. ring protein protein. 33 0.78 X58531-1|CAA41418.1| 2628|Homo sapiens laminin A chain protein. 33 0.78 BC109063-1|AAI09064.1| 485|Homo sapiens tripartite motif-contai... 33 0.78 BC075058-1|AAH75058.1| 485|Homo sapiens tripartite motif-contai... 33 0.78 AF439153-1|AAL31641.1| 485|Homo sapiens Ro/SSA1 related protein... 33 0.78 AF360739-1|AAL11501.1| 485|Homo sapiens SSA protein SS-56 protein. 33 0.78 AF230387-1|AAG50166.1| 267|Homo sapiens tripartite motif protei... 33 0.78 AF230386-1|AAG50165.1| 425|Homo sapiens tripartite motif protei... 33 0.78 U78798-1|AAB38751.1| 522|Homo sapiens putative interleukin 1 si... 32 1.0 U69108-1|AAC51329.1| 538|Homo sapiens TNF receptor associated f... 32 1.0 CR536557-1|CAG38794.1| 557|Homo sapiens TRAF5 protein. 32 1.0 BX897730-1|CAM26290.1| 425|Homo sapiens tripartite motif-contai... 32 1.0 BX322644-1|CAI18447.1| 425|Homo sapiens tripartite motif-contai... 32 1.0 BX088647-1|CAM26282.1| 425|Homo sapiens tripartite motif-contai... 32 1.0 BX005441-1|CAM26234.1| 425|Homo sapiens tripartite motif-contai... 32 1.0 BT007212-1|AAP35876.1| 436|Homo sapiens ring finger protein 29 ... 32 1.0 BT006675-1|AAP35321.1| 425|Homo sapiens tripartite motif-contai... 32 1.0 BC063872-1|AAH63872.1| 710|Homo sapiens tripartite motif-contai... 32 1.0 BC047564-1|AAH47564.1| 516|Homo sapiens tripartite motif-contai... 32 1.0 BC032830-1|AAH32830.1| 149|Homo sapiens TRAF5 protein protein. 32 1.0 BC031052-1|AAH31052.1| 522|Homo sapiens TNF receptor-associated... 32 1.0 BC029600-1|AAH29600.1| 557|Homo sapiens TNF receptor-associated... 32 1.0 BC017017-1|AAH17017.1| 425|Homo sapiens tripartite motif-contai... 32 1.0 BC013414-1|AAH13414.1| 550|Homo sapiens tripartite motif-contai... 32 1.0 BC007750-1|AAH07750.2| 452|Homo sapiens tripartite motif-contai... 32 1.0 AY228337-1|AAO38054.1| 522|Homo sapiens TNF receptor-associated... 32 1.0 AL671859-7|CAI17583.1| 425|Homo sapiens tripartite motif-contai... 32 1.0 AL669914-7|CAI18183.1| 425|Homo sapiens tripartite motif-contai... 32 1.0 AL590101-3|CAH72434.1| 557|Homo sapiens TNF receptor-associated... 32 1.0 AK222729-1|BAD96449.1| 425|Homo sapiens tripartite motif protei... 32 1.0 AK055388-1|BAB70913.1| 802|Homo sapiens protein ( Homo sapiens ... 32 1.0 AK027664-1|BAB55276.1| 488|Homo sapiens protein ( Homo sapiens ... 32 1.0 AJ431704-1|CAD24432.1| 540|Homo sapiens RING finger protein 29 ... 32 1.0 AJ291712-2|CAC32840.1| 532|Homo sapiens ring finger protein 29 ... 32 1.0 AJ291712-1|CAC32839.1| 436|Homo sapiens ring finger protein 29 ... 32 1.0 AJ277493-1|CAC81835.1| 241|Homo sapiens RING finger protein 29 ... 32 1.0 AJ243489-1|CAC43020.1| 548|Homo sapiens RING finger protein 29 ... 32 1.0 AJ243488-1|CAC43019.1| 452|Homo sapiens RING finger protein 29 ... 32 1.0 AF220038-1|AAG53492.1| 664|Homo sapiens tripartite motif protei... 32 1.0 AF220037-1|AAG53491.1| 710|Homo sapiens tripartite motif protei... 32 1.0 AF220036-1|AAG53490.1| 664|Homo sapiens tripartite motif protei... 32 1.0 AF220030-1|AAG53484.1| 488|Homo sapiens tripartite motif protei... 32 1.0 AB202083-1|BAE78603.1| 425|Homo sapiens tripartite motif-contai... 32 1.0 AB000509-1|BAA25262.1| 557|Homo sapiens TRAF5 protein. 32 1.0 BX088647-7|CAM26287.1| 420|Homo sapiens ring finger protein 39 ... 32 1.4 BX088647-6|CAM26286.1| 354|Homo sapiens ring finger protein 39 ... 32 1.4 BT006795-1|AAP35441.1| 228|Homo sapiens zinc finger protein 313... 32 1.4 BC141807-1|AAI41808.1| 358|Homo sapiens tripartite motif-contai... 32 1.4 BC127195-1|AAI27196.1| 110|Homo sapiens TRIM41 protein protein. 32 1.4 BC126422-1|AAI26423.1| 432|Homo sapiens ring finger protein 135... 32 1.4 BC126420-1|AAI26421.1| 432|Homo sapiens ring finger protein 135... 32 1.4 BC117385-1|AAI17386.1| 416|Homo sapiens LONRF1 protein protein. 32 1.4 BC117381-1|AAI17382.1| 416|Homo sapiens LONRF1 protein protein. 32 1.4 BC090953-1|AAH90953.1| 630|Homo sapiens tripartite motif-contai... 32 1.4 BC066919-1|AAH66919.1| 228|Homo sapiens zinc finger protein 313... 32 1.4 BC017226-1|AAH17226.1| 237|Homo sapiens ring finger protein 166... 32 1.4 BC013948-1|AAH13948.1| 237|Homo sapiens ring finger protein 166... 32 1.4 BC013695-1|AAH13695.1| 228|Homo sapiens zinc finger protein 313... 32 1.4 BC012758-1|AAH12758.1| 267|Homo sapiens RNF187 protein protein. 32 1.4 BC005084-1|AAH05084.1| 210|Homo sapiens ring finger protein 135... 32 1.4 BA000025-89|BAB63333.1| 420|Homo sapiens HCGV protein. 32 1.4 AY598332-1|AAT06743.1| 432|Homo sapiens L13 protein. 32 1.4 AL845439-6|CAI18544.1| 420|Homo sapiens ring finger protein 39 ... 32 1.4 AL845439-5|CAI18543.1| 354|Homo sapiens ring finger protein 39 ... 32 1.4 AL671859-6|CAI17581.1| 420|Homo sapiens ring finger protein 39 ... 32 1.4 AL671859-5|CAI17580.1| 354|Homo sapiens ring finger protein 39 ... 32 1.4 AL669914-6|CAI18180.1| 420|Homo sapiens ring finger protein 39 ... 32 1.4 AL669914-5|CAI18179.1| 354|Homo sapiens ring finger protein 39 ... 32 1.4 AL031685-2|CAB46028.1| 228|Homo sapiens zinc finger protein 313... 32 1.4 AJ496729-1|CAD43140.1| 432|Homo sapiens hypothetical protein pr... 32 1.4 AJ291714-2|CAC32842.1| 384|Homo sapiens ring finger protein 30 ... 32 1.4 AJ291714-1|CAC32841.1| 342|Homo sapiens ring finger protein 30 ... 32 1.4 AF265215-1|AAF75763.1| 228|Homo sapiens zinc finger protein 313... 32 1.4 AF238317-1|AAG40630.1| 256|Homo sapiens HZFw3 protein protein. 32 1.4 AF238316-1|AAG40629.1| 354|Homo sapiens HZFw2 protein protein. 32 1.4 AF238315-1|AAG40628.1| 420|Homo sapiens HZFw1 protein protein. 32 1.4 AC013413-4|AAY24296.1| 384|Homo sapiens unknown protein. 32 1.4 AB202082-3|BAE78602.1| 420|Homo sapiens ring finger protein 39 ... 32 1.4 AB100367-1|BAD07473.1| 518|Homo sapiens hypothetical protein pr... 32 1.4 AB100366-1|BAD07472.1| 630|Homo sapiens hypothetical protein pr... 32 1.4 AB088087-2|BAC54920.1| 420|Homo sapiens HZFW1 protein. 32 1.4 U43895-1|AAC51929.1| 777|Homo sapiens hepatocyte growth factor-... 31 1.8 D84064-1|BAA23366.1| 777|Homo sapiens Hrs protein. 31 1.8 BT009754-1|AAP88756.1| 777|Homo sapiens hepatocyte growth facto... 31 1.8 BT007373-1|AAP36037.1| 346|Homo sapiens ring finger protein 28 ... 31 1.8 BC117686-1|AAI17687.1| 1683|Homo sapiens SHPRH protein protein. 31 1.8 BC080529-1|AAH80529.1| 353|Homo sapiens tripartite motif-contai... 31 1.8 BC053989-1|AAH53989.1| 631|Homo sapiens zinc finger protein 179... 31 1.8 BC003565-1|AAH03565.1| 777|Homo sapiens hepatocyte growth facto... 31 1.8 AY163808-1|AAO06907.1| 1659|Homo sapiens helicase-like protein p... 31 1.8 AY161136-1|AAO26201.1| 1683|Homo sapiens SNF2 histone linker PHD... 31 1.8 AL451145-1|CAH70765.1| 1683|Homo sapiens SNF2 histone linker PHD... 31 1.8 AL391650-4|CAI17133.1| 353|Homo sapiens tripartite motif-contai... 31 1.8 AL356599-2|CAI41120.1| 1683|Homo sapiens SNF2 histone linker PHD... 31 1.8 AK056942-1|BAB71318.1| 353|Homo sapiens protein ( Homo sapiens ... 31 1.8 AJ291713-1|CAC33173.1| 340|Homo sapiens ring finger protein 28 ... 31 1.8 AJ276484-1|CAC81706.1| 353|Homo sapiens muscle specific RING fi... 31 1.8 AF361946-1|AAK52497.1| 288|Homo sapiens RING zinc finger protei... 31 1.8 AF353673-1|AAK39519.1| 353|Homo sapiens iris ring finger protei... 31 1.8 AF260566-1|AAF82361.1| 690|Homo sapiens hepatocyte growth facto... 31 1.8 AF054587-1|AAC08584.1| 95|Homo sapiens brain finger protein pr... 31 1.8 AB095943-1|BAC23119.1| 1092|Homo sapiens KIAA2023 protein protein. 31 1.8 AB026054-1|BAA84698.1| 632|Homo sapiens brain finger protein pr... 31 1.8 U67322-1|AAD00162.1| 468|Homo sapiens HBV associated factor pro... 31 2.4 U64805-1|AAC00049.1| 759|Homo sapiens Brca1-delta11b protein. 31 2.4 U14680-1|AAA73985.1| 1863|Homo sapiens breast and ovarian cancer... 31 2.4 U09825-1|AAA93131.1| 539|Homo sapiens acid finger protein protein. 31 2.4 L78833-1|AAC37594.1| 1863|Homo sapiens BRCA1 protein. 31 2.4 D21205-1|BAA04747.1| 630|Homo sapiens estrogen responsive finge... 31 2.4 DQ478408-3|ABF14462.1| 1822|Homo sapiens early onset breast canc... 31 2.4 DQ190457-3|ABA29229.1| 1822|Homo sapiens breast cancer 1 early o... 31 2.4 DQ190456-3|ABA29226.1| 1863|Homo sapiens breast cancer 1 early o... 31 2.4 DQ190455-3|ABA29223.1| 1863|Homo sapiens breast cancer 1 early o... 31 2.4 DQ190454-3|ABA29220.1| 1863|Homo sapiens breast cancer 1 early o... 31 2.4 DQ190453-3|ABA29217.1| 1863|Homo sapiens breast cancer 1 early o... 31 2.4 DQ190452-3|ABA29214.1| 1863|Homo sapiens breast cancer 1 early o... 31 2.4 DQ190451-3|ABA29211.1| 1863|Homo sapiens breast cancer 1 early o... 31 2.4 DQ190450-3|ABA29208.1| 1863|Homo sapiens breast cancer 1 early o... 31 2.4 BX248419-7|CAM26027.1| 159|Homo sapiens tripartite motif-contai... 31 2.4 BX248419-6|CAM26026.1| 122|Homo sapiens tripartite motif-contai... 31 2.4 BX248419-5|CAM26025.1| 157|Homo sapiens tripartite motif-contai... 31 2.4 BX248419-4|CAM26024.1| 248|Homo sapiens tripartite motif-contai... 31 2.4 BX248419-3|CAM26023.1| 539|Homo sapiens tripartite motif-contai... 31 2.4 BC132798-1|AAI32799.1| 263|Homo sapiens ret finger protein-like... 31 2.4 BC132796-1|AAI32797.1| 263|Homo sapiens ret finger protein-like... 31 2.4 BC114469-1|AAI14470.1| 468|Homo sapiens tripartite motif family... 31 2.4 BC113860-1|AAI13861.1| 468|Homo sapiens tripartite motif family... 31 2.4 BC106745-1|AAI06746.1| 473|Homo sapiens BRCA1 protein protein. 31 2.4 BC085615-1|AAH85615.1| 624|Homo sapiens BRCA1 protein protein. 31 2.4 BC072418-1|AAH72418.1| 699|Homo sapiens BRCA1 protein protein. 31 2.4 BC042541-1|AAH42541.1| 630|Homo sapiens tripartite motif-contai... 31 2.4 BC032297-1|AAH32297.1| 539|Homo sapiens TRIM26 protein protein. 31 2.4 BC030969-1|AAH30969.1| 657|Homo sapiens BRCA1 protein protein. 31 2.4 BC024039-1|AAH24039.1| 539|Homo sapiens tripartite motif-contai... 31 2.4 BC016924-1|AAH16924.1| 630|Homo sapiens tripartite motif-contai... 31 2.4 BC015219-1|AAH15219.2| 500|Homo sapiens RanBP-type and C3HC4-ty... 31 2.4 BA000025-86|BAB63330.1| 539|Homo sapiens ZNF173 protein. 31 2.4 AY751490-1|AAU93634.1| 1841|Homo sapiens breast and ovarian canc... 31 2.4 AY358263-1|AAQ88630.1| 99|Homo sapiens AHPA9419 protein. 31 2.4 AY354539-1|AAQ92977.1| 1399|Homo sapiens IRIS protein. 31 2.4 AY273801-1|AAP12647.1| 1863|Homo sapiens breast cancer 1, early ... 31 2.4 AL845450-2|CAI17701.1| 539|Homo sapiens tripartite motif-contai... 31 2.4 AL844220-9|CAM25796.1| 122|Homo sapiens tripartite motif-contai... 31 2.4 AL844220-8|CAI18615.2| 157|Homo sapiens tripartite motif-contai... 31 2.4 AL844220-7|CAM25795.1| 248|Homo sapiens tripartite motif-contai... 31 2.4 AL844220-6|CAI18614.1| 539|Homo sapiens tripartite motif-contai... 31 2.4 AL671855-7|CAM25550.1| 159|Homo sapiens tripartite motif-contai... 31 2.4 AL671855-6|CAM25549.1| 122|Homo sapiens tripartite motif-contai... 31 2.4 AL671855-5|CAM25548.1| 157|Homo sapiens tripartite motif-contai... 31 2.4 AL671855-4|CAM25547.1| 248|Homo sapiens tripartite motif-contai... 31 2.4 AL671855-3|CAI18235.1| 539|Homo sapiens tripartite motif-contai... 31 2.4 AL662832-5|CAO72122.1| 159|Homo sapiens tripartite motif-contai... 31 2.4 AL662832-4|CAO72121.1| 122|Homo sapiens tripartite motif-contai... 31 2.4 AL662832-3|CAI17497.1| 539|Homo sapiens tripartite motif-contai... 31 2.4 AL662832-2|CAO72120.1| 157|Homo sapiens tripartite motif-contai... 31 2.4 AL662832-1|CAO72119.1| 248|Homo sapiens tripartite motif-contai... 31 2.4 AL121747-9|CAC28312.2| 510|Homo sapiens RanBP-type and C3HC4-ty... 31 2.4 AL121747-3|CAC17516.1| 468|Homo sapiens RanBP-type and C3HC4-ty... 31 2.4 AK122906-1|BAC85513.1| 263|Homo sapiens 22D). protein. 31 2.4 AK093499-1|BAC04185.1| 468|Homo sapiens protein ( Homo sapiens ... 31 2.4 AB208994-1|BAD92231.1| 644|Homo sapiens tripartite motif-contai... 31 2.4 AB202086-1|BAE78607.1| 539|Homo sapiens tripartite motif-contai... 31 2.4 AB107766-1|BAC75409.1| 468|Homo sapiens ubiquitin ligase protein. 31 2.4 AB103596-1|BAF31258.1| 539|Homo sapiens Zn-finger protein protein. 31 2.4 AB088090-1|BAC54923.1| 539|Homo sapiens tripartite motif-contai... 31 2.4 AB037360-1|BAA90300.1| 1166|Homo sapiens ANKHZN protein. 31 2.4 AB033081-1|BAA86569.2| 1232|Homo sapiens KIAA1255 protein protein. 31 2.4 BC055285-1|AAH55285.1| 1439|Homo sapiens AT-hook transcription f... 31 3.2 BC022983-1|AAH22983.1| 728|Homo sapiens LNX1 protein protein. 31 3.2 BC015353-1|AAH15353.1| 446|Homo sapiens tripartite motif-contai... 31 3.2 AY703044-1|AAU34191.1| 1358|Homo sapiens AKNA transcript E protein. 31 3.2 AY703043-1|AAU34190.1| 1439|Homo sapiens AKNA transcript D protein. 31 3.2 AY703042-1|AAU34189.1| 612|Homo sapiens AKNA transcript C2 prot... 31 3.2 AY703041-1|AAU34188.1| 674|Homo sapiens AKNA transcript C1 prot... 31 3.2 AY703040-1|AAU34187.1| 1364|Homo sapiens AKNA transcript B1 prot... 31 3.2 AY703039-1|AAU34186.1| 1320|Homo sapiens AKNA transcript A protein. 31 3.2 AL356796-7|CAI16863.1| 831|Homo sapiens AT-hook transcription f... 31 3.2 AL356796-6|CAI16862.2| 1439|Homo sapiens AT-hook transcription f... 31 3.2 AL356796-5|CAM23638.1| 1358|Homo sapiens AT-hook transcription f... 31 3.2 AL117478-1|CAB55951.1| 698|Homo sapiens hypothetical protein pr... 31 3.2 AK160382-1|BAD18725.1| 851|Homo sapiens FLJ00356 protein protein. 31 3.2 AK131082-1|BAC85132.1| 1495|Homo sapiens FLJ00281 protein protein. 31 3.2 AK126136-1|BAC86459.1| 572|Homo sapiens protein ( Homo sapiens ... 31 3.2 AK056823-1|BAB71291.1| 728|Homo sapiens protein ( Homo sapiens ... 31 3.2 AK024431-1|BAB15721.1| 1142|Homo sapiens FLJ00020 protein protein. 31 3.2 AC095040-1|AAY41000.1| 126|Homo sapiens unknown protein. 31 3.2 AC009237-2|AAY14782.1| 446|Homo sapiens unknown protein. 31 3.2 AB075848-1|BAB85554.1| 860|Homo sapiens KIAA1968 protein protein. 31 3.2 X91906-1|CAA63000.1| 746|Homo sapiens voltage-gated chloride io... 30 4.2 X81836-1|CAA57430.1| 260|Homo sapiens Dents disease candidate p... 30 4.2 BC130431-1|AAI30432.1| 746|Homo sapiens CLCN5 protein protein. 30 4.2 BC130429-1|AAI30430.1| 746|Homo sapiens CLCN5 protein protein. 30 4.2 BC069226-1|AAH69226.1| 493|Homo sapiens tripartite motif-contai... 30 4.2 BC021925-1|AAH21925.1| 551|Homo sapiens tripartite motif-contai... 30 4.2 BC018337-1|AAH18337.1| 206|Homo sapiens TRIM35 protein protein. 30 4.2 BC012152-1|AAH12152.1| 475|Homo sapiens tripartite motif-contai... 30 4.2 BC011689-1|AAH11689.1| 475|Homo sapiens tripartite motif-contai... 30 4.2 BC007999-1|AAH07999.1| 475|Homo sapiens tripartite motif-contai... 30 4.2 BC001222-1|AAH01222.1| 475|Homo sapiens tripartite motif-contai... 30 4.2 AL663118-1|CAI41555.1| 746|Homo sapiens chloride channel 5 (nep... 30 4.2 AL662907-2|CAH70402.1| 475|Homo sapiens tripartite motif-contai... 30 4.2 AL662907-1|CAH70401.1| 394|Homo sapiens tripartite motif-contai... 30 4.2 AL391121-3|CAI40861.1| 550|Homo sapiens tripartite motif-contai... 30 4.2 AK001621-1|BAA91792.1| 475|Homo sapiens protein ( Homo sapiens ... 30 4.2 AF492463-1|AAO85480.1| 493|Homo sapiens hemopoeitic lineage swi... 30 4.2 AF281046-1|AAG53087.1| 551|Homo sapiens glioblastoma-expressed ... 30 4.2 AF220034-1|AAG53488.1| 551|Homo sapiens tripartite motif protei... 30 4.2 AB208969-1|BAD92206.1| 980|Homo sapiens KIAA0182 protein varian... 30 4.2 AB029021-1|BAA83050.1| 504|Homo sapiens KIAA1098 protein protein. 30 4.2 X63131-1|CAA44841.1| 633|Homo sapiens My1 (PML) protein. 30 5.5 S50913-1|AAB19601.2| 641|Homo sapiens PML protein. 30 5.5 M80185-1|AAA60352.1| 538|Homo sapiens PML protein. 30 5.5 M79464-1|AAA60390.1| 802|Homo sapiens PML protein. 30 5.5 M79463-1|AAA60351.1| 589|Homo sapiens PML protein. 30 5.5 M79462-1|AAA60388.1| 860|Homo sapiens PML protein. 30 5.5 M73779-1|AAA60126.1| 797|Homo sapiens PML-RAR protein protein. 30 5.5 M73778-1|AAA60125.1| 560|Homo sapiens PML-1 protein protein. 30 5.5 DQ307286-1|ABC25188.1| 269|Homo sapiens plenty of SH3s-2 protein. 30 5.5 DQ020495-1|AAY84832.1| 754|Homo sapiens neuroblastoma apoptosis... 30 5.5 BT009911-1|AAP88913.1| 781|Homo sapiens promyelocytic leukemia ... 30 5.5 BC125107-1|AAI25108.1| 729|Homo sapiens SH3 domain containing r... 30 5.5 BC125106-1|AAI25107.1| 729|Homo sapiens SH3 domain containing r... 30 5.5 BC101664-1|AAI01665.1| 511|Homo sapiens LON peptidase N-termina... 30 5.5 BC101662-1|AAI01663.1| 511|Homo sapiens LON peptidase N-termina... 30 5.5 BC069227-1|AAH69227.1| 468|Homo sapiens tripartite motif-contai... 30 5.5 BC020994-1|AAH20994.1| 781|Homo sapiens promyelocytic leukemia ... 30 5.5 BC000080-1|AAH00080.2| 781|Homo sapiens promyelocytic leukemia ... 30 5.5 AY253917-1|AAP69949.1| 721|Homo sapiens TRIM9-like protein TNL ... 30 5.5 AL670729-2|CAH71672.1| 385|Homo sapiens tripartite motif-contai... 30 5.5 AL670729-1|CAH71671.1| 468|Homo sapiens tripartite motif-contai... 30 5.5 AL109810-3|CAI19161.1| 721|Homo sapiens tripartite motif-contai... 30 5.5 AL109810-2|CAI19160.1| 746|Homo sapiens tripartite motif-contai... 30 5.5 AK127206-1|BAC86883.1| 511|Homo sapiens protein ( Homo sapiens ... 30 5.5 AK074866-1|BAC11254.1| 385|Homo sapiens protein ( Homo sapiens ... 30 5.5 AK074234-1|BAB85025.1| 457|Homo sapiens protein ( Homo sapiens ... 30 5.5 AF327056-1|AAM63957.1| 468|Homo sapiens BIA1 protein protein. 30 5.5 AF230411-1|AAG50190.1| 585|Homo sapiens tripartite motif protei... 30 5.5 AF230410-1|AAG50189.1| 829|Homo sapiens tripartite motif protei... 30 5.5 AF230409-1|AAG50188.1| 423|Homo sapiens tripartite motif protei... 30 5.5 AF230408-1|AAG50187.1| 435|Homo sapiens tripartite motif protei... 30 5.5 AF230407-1|AAG50186.1| 423|Homo sapiens tripartite motif protei... 30 5.5 AF230406-1|AAG50185.1| 633|Homo sapiens tripartite motif protei... 30 5.5 AF230405-1|AAG50184.1| 560|Homo sapiens tripartite motif protei... 30 5.5 AF230404-1|AAG50183.1| 854|Homo sapiens tripartite motif protei... 30 5.5 AF230403-1|AAG50182.1| 824|Homo sapiens tripartite motif protei... 30 5.5 AF230402-1|AAG50181.1| 611|Homo sapiens tripartite motif protei... 30 5.5 AF230401-1|AAG50180.1| 882|Homo sapiens tripartite motif protei... 30 5.5 AB209411-1|BAD92648.1| 862|Homo sapiens promyelocytic leukemia ... 30 5.5 AB209051-1|BAD92288.1| 372|Homo sapiens promyelocytic leukemia ... 30 5.5 AB208950-1|BAD92187.1| 571|Homo sapiens promyelocytic leukemia ... 30 5.5 BX248419-8|CAM26028.1| 465|Homo sapiens tripartite motif-contai... 29 7.3 BX005441-6|CAM26239.1| 465|Homo sapiens tripartite motif-contai... 29 7.3 BC075791-1|AAH75791.1| 388|Homo sapiens homeobox A13 protein. 29 7.3 BC071887-1|AAH71887.1| 361|Homo sapiens TRIM41 protein protein. 29 7.3 BC038585-1|AAH38585.1| 465|Homo sapiens tripartite motif-contai... 29 7.3 BC033788-1|AAH33788.1| 477|Homo sapiens tripartite motif-contai... 29 7.3 BC021259-1|AAH21259.2| 517|Homo sapiens tripartite motif-contai... 29 7.3 BC004956-1|AAH04956.1| 361|Homo sapiens Unknown (protein for IM... 29 7.3 BA000025-87|BAB63331.1| 465|Homo sapiens ZNFB7 protein. 29 7.3 AY442331-1|AAS01604.1| 469|Homo sapiens zinc finger protein ZNF... 29 7.3 AY442330-1|AAS01603.1| 522|Homo sapiens zinc finger protein ZNF... 29 7.3 >AL136170-1|CAI19418.1| 1133|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1133 Score = 95.1 bits (226), Expect = 1e-19 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = +1 Query: 82 MPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTII 252 MP+QAPQWTD+L+CP+C + F R PISL CGHT+C+ CL LHRK CPFDQT I Sbjct: 1 MPVQAPQWTDFLSCPICTQTFDETIRKPISLGCGHTVCKMCLNKLHRKACPFDQTTI 57 Score = 53.6 bits (123), Expect = 4e-07 Identities = 38/85 (44%), Positives = 50/85 (58%), Gaps = 4/85 (4%) Frame = +3 Query: 264 EELVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLKCSGNANM 443 E L VN+ALLQL G P Q QP + + E D + Y+ + +EELA++LK +A Sbjct: 62 ELLPVNSALLQLVGAQVPEQ--QPITLCSGVE-DTKHYEEAKKCVEELALYLKPLSSARG 118 Query: 444 SGXXNR----LSRPMQRKLVTLLQC 506 G + LSRPMQRKLVTL+ C Sbjct: 119 VGLNSTTQSVLSRPMQRKLVTLVHC 143 >AL121983-1|CAI12318.1| 1133|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1133 Score = 95.1 bits (226), Expect = 1e-19 Identities = 37/57 (64%), Positives = 44/57 (77%) Frame = +1 Query: 82 MPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTII 252 MP+QAPQWTD+L+CP+C + F R PISL CGHT+C+ CL LHRK CPFDQT I Sbjct: 1 MPVQAPQWTDFLSCPICTQTFDETIRKPISLGCGHTVCKMCLNKLHRKACPFDQTTI 57 Score = 53.6 bits (123), Expect = 4e-07 Identities = 38/85 (44%), Positives = 50/85 (58%), Gaps = 4/85 (4%) Frame = +3 Query: 264 EELVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLKCSGNANM 443 E L VN+ALLQL G P Q QP + + E D + Y+ + +EELA++LK +A Sbjct: 62 ELLPVNSALLQLVGAQVPEQ--QPITLCSGVE-DTKHYEEAKKCVEELALYLKPLSSARG 118 Query: 444 SGXXNR----LSRPMQRKLVTLLQC 506 G + LSRPMQRKLVTL+ C Sbjct: 119 VGLNSTTQSVLSRPMQRKLVTLVHC 143 >BC044642-1|AAH44642.1| 506|Homo sapiens RC3H2 protein protein. Length = 506 Score = 87.4 bits (207), Expect = 3e-17 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +1 Query: 82 MPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTII 252 MP+QA QWT++L+CP+C EF PISL C HT+C+ CL LHRK CPFDQT I Sbjct: 1 MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAI 57 Score = 48.8 bits (111), Expect = 1e-05 Identities = 33/81 (40%), Positives = 43/81 (53%), Gaps = 2/81 (2%) Frame = +3 Query: 270 LVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLK--CSGNANM 443 L VN ALLQL G P IK + + Y+ + +E+LA++LK G Sbjct: 64 LPVNFALLQLVGAQVPDHQ----SIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGVA 119 Query: 444 SGXXNRLSRPMQRKLVTLLQC 506 S + LSRPMQRKLVTL+ C Sbjct: 120 SLNQSALSRPMQRKLVTLVNC 140 >AL359512-8|CAI94964.1| 1191|Homo sapiens ring finger and CCCH-type zinc finger domains 2 protein. Length = 1191 Score = 87.4 bits (207), Expect = 3e-17 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +1 Query: 82 MPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTII 252 MP+QA QWT++L+CP+C EF PISL C HT+C+ CL LHRK CPFDQT I Sbjct: 1 MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAI 57 Score = 48.8 bits (111), Expect = 1e-05 Identities = 33/81 (40%), Positives = 43/81 (53%), Gaps = 2/81 (2%) Frame = +3 Query: 270 LVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLK--CSGNANM 443 L VN ALLQL G P IK + + Y+ + +E+LA++LK G Sbjct: 64 LPVNFALLQLVGAQVPDHQ----SIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGVA 119 Query: 444 SGXXNRLSRPMQRKLVTLLQC 506 S + LSRPMQRKLVTL+ C Sbjct: 120 SLNQSALSRPMQRKLVTLVNC 140 >AF255303-1|AAG00432.1| 1048|Homo sapiens membrane-associated nucleic acid binding protein protein. Length = 1048 Score = 87.4 bits (207), Expect = 3e-17 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +1 Query: 82 MPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTII 252 MP+QA QWT++L+CP+C EF PISL C HT+C+ CL LHRK CPFDQT I Sbjct: 1 MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAI 57 Score = 48.8 bits (111), Expect = 1e-05 Identities = 33/81 (40%), Positives = 43/81 (53%), Gaps = 2/81 (2%) Frame = +3 Query: 270 LVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLK--CSGNANM 443 L VN ALLQL G P IK + + Y+ + +E+LA++LK G Sbjct: 64 LPVNFALLQLVGAQVPDHQ----SIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGVA 119 Query: 444 SGXXNRLSRPMQRKLVTLLQC 506 S + LSRPMQRKLVTL+ C Sbjct: 120 SLNQSALSRPMQRKLVTLVNC 140 >AB095945-1|BAC23121.1| 1109|Homo sapiens KIAA2025 protein protein. Length = 1109 Score = 57.6 bits (133), Expect = 2e-08 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = +1 Query: 157 RSPISLSCGHTLCRHCLIHLHRKQCPFDQTII 252 R PISL CGHT+C+ CL LHRK CPFDQT I Sbjct: 2 RKPISLGCGHTVCKMCLNKLHRKACPFDQTTI 33 Score = 53.6 bits (123), Expect = 4e-07 Identities = 38/85 (44%), Positives = 50/85 (58%), Gaps = 4/85 (4%) Frame = +3 Query: 264 EELVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLKCSGNANM 443 E L VN+ALLQL G P Q QP + + E D + Y+ + +EELA++LK +A Sbjct: 38 ELLPVNSALLQLVGAQVPEQ--QPITLCSGVE-DTKHYEEAKKCVEELALYLKPLSSARG 94 Query: 444 SGXXNR----LSRPMQRKLVTLLQC 506 G + LSRPMQRKLVTL+ C Sbjct: 95 VGLNSTTQSVLSRPMQRKLVTLVHC 119 >AL136170-3|CAI19419.1| 1086|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1086 Score = 53.6 bits (123), Expect = 4e-07 Identities = 38/85 (44%), Positives = 50/85 (58%), Gaps = 4/85 (4%) Frame = +3 Query: 264 EELVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLKCSGNANM 443 E L VN+ALLQL G P Q QP + + E D + Y+ + +EELA++LK +A Sbjct: 23 ELLPVNSALLQLVGAQVPEQ--QPITLCSGVE-DTKHYEEAKKCVEELALYLKPLSSARG 79 Query: 444 SGXXNR----LSRPMQRKLVTLLQC 506 G + LSRPMQRKLVTL+ C Sbjct: 80 VGLNSTTQSVLSRPMQRKLVTLVHC 104 Score = 32.7 bits (71), Expect = 0.78 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 202 CLIHLHRKQCPFDQTII 252 CL LHRK CPFDQT I Sbjct: 2 CLNKLHRKACPFDQTTI 18 >AL136170-2|CAI19417.1| 1094|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1094 Score = 53.6 bits (123), Expect = 4e-07 Identities = 38/85 (44%), Positives = 50/85 (58%), Gaps = 4/85 (4%) Frame = +3 Query: 264 EELVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLKCSGNANM 443 E L VN+ALLQL G P Q QP + + E D + Y+ + +EELA++LK +A Sbjct: 23 ELLPVNSALLQLVGAQVPEQ--QPITLCSGVE-DTKHYEEAKKCVEELALYLKPLSSARG 79 Query: 444 SGXXNR----LSRPMQRKLVTLLQC 506 G + LSRPMQRKLVTL+ C Sbjct: 80 VGLNSTTQSVLSRPMQRKLVTLVHC 104 Score = 32.7 bits (71), Expect = 0.78 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 202 CLIHLHRKQCPFDQTII 252 CL LHRK CPFDQT I Sbjct: 2 CLNKLHRKACPFDQTTI 18 >AL121983-3|CAH70710.1| 1086|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1086 Score = 53.6 bits (123), Expect = 4e-07 Identities = 38/85 (44%), Positives = 50/85 (58%), Gaps = 4/85 (4%) Frame = +3 Query: 264 EELVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLKCSGNANM 443 E L VN+ALLQL G P Q QP + + E D + Y+ + +EELA++LK +A Sbjct: 23 ELLPVNSALLQLVGAQVPEQ--QPITLCSGVE-DTKHYEEAKKCVEELALYLKPLSSARG 79 Query: 444 SGXXNR----LSRPMQRKLVTLLQC 506 G + LSRPMQRKLVTL+ C Sbjct: 80 VGLNSTTQSVLSRPMQRKLVTLVHC 104 Score = 32.7 bits (71), Expect = 0.78 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 202 CLIHLHRKQCPFDQTII 252 CL LHRK CPFDQT I Sbjct: 2 CLNKLHRKACPFDQTTI 18 >AL121983-2|CAH70709.1| 1094|Homo sapiens ring finger and CCCH-type zinc finger domains 1 protein. Length = 1094 Score = 53.6 bits (123), Expect = 4e-07 Identities = 38/85 (44%), Positives = 50/85 (58%), Gaps = 4/85 (4%) Frame = +3 Query: 264 EELVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLKCSGNANM 443 E L VN+ALLQL G P Q QP + + E D + Y+ + +EELA++LK +A Sbjct: 23 ELLPVNSALLQLVGAQVPEQ--QPITLCSGVE-DTKHYEEAKKCVEELALYLKPLSSARG 79 Query: 444 SGXXNR----LSRPMQRKLVTLLQC 506 G + LSRPMQRKLVTL+ C Sbjct: 80 VGLNSTTQSVLSRPMQRKLVTLVHC 104 Score = 32.7 bits (71), Expect = 0.78 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +1 Query: 202 CLIHLHRKQCPFDQTII 252 CL LHRK CPFDQT I Sbjct: 2 CLNKLHRKACPFDQTTI 18 >BC011688-1|AAH11688.2| 177|Homo sapiens Unknown (protein for IMAGE:4329353) protein. Length = 177 Score = 48.8 bits (111), Expect = 1e-05 Identities = 33/81 (40%), Positives = 43/81 (53%), Gaps = 2/81 (2%) Frame = +3 Query: 270 LVVNTALLQLAGYAPPSQPYQPPCIKALPESDRQAYDTVIRTMEELAVFLK--CSGNANM 443 L VN ALLQL G P IK + + Y+ + +E+LA++LK G Sbjct: 23 LPVNFALLQLVGAQVPDHQ----SIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGVA 78 Query: 444 SGXXNRLSRPMQRKLVTLLQC 506 S + LSRPMQRKLVTL+ C Sbjct: 79 SLNQSALSRPMQRKLVTLVNC 99 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 Query: 214 LHRKQCPFDQTII 252 LHRK CPFDQT I Sbjct: 4 LHRKACPFDQTAI 16 >BC112154-1|AAI12155.1| 487|Homo sapiens tripartite motif protein 50A protein. Length = 487 Score = 41.9 bits (94), Expect = 0.001 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +1 Query: 88 IQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 + P+ D L CP+C F + P+ L CGH+ C+ CL+ L Sbjct: 5 VSLPELEDRLQCPICLEVF----KEPLMLQCGHSYCKGCLVSL 43 >BC112152-1|AAI12153.1| 487|Homo sapiens tripartite motif protein 50A protein. Length = 487 Score = 41.9 bits (94), Expect = 0.001 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +1 Query: 88 IQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 + P+ D L CP+C F + P+ L CGH+ C+ CL+ L Sbjct: 5 VSLPELEDRLQCPICLEVF----KEPLMLQCGHSYCKGCLVSL 43 >BC003154-1|AAH03154.1| 653|Homo sapiens tripartite motif-containing 32 protein. Length = 653 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL-----HRKQCPFDQTIIQL 258 + L CP+C F P L CGHT+CR CL L + +CPF I ++ Sbjct: 16 EVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI 70 >AL133284-7|CAB92723.1| 653|Homo sapiens tripartite motif-containing 32 protein. Length = 653 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL-----HRKQCPFDQTIIQL 258 + L CP+C F P L CGHT+CR CL L + +CPF I ++ Sbjct: 16 EVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI 70 >AL133284-6|CAI16372.1| 173|Homo sapiens tripartite motif-containing 32 protein. Length = 173 Score = 41.9 bits (94), Expect = 0.001 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL-----HRKQCPFDQTIIQL 258 + L CP+C F P L CGHT+CR CL L + +CPF I ++ Sbjct: 16 EVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI 70 >BC025949-1|AAH25949.1| 294|Homo sapiens TRIM4 protein protein. Length = 294 Score = 40.7 bits (91), Expect = 0.003 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +1 Query: 88 IQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 ++A + LTCP+C F + P+S+ CGH CR C LHR P Sbjct: 1 MEAEDIQEELTCPICLDYF----QDPVSIECGHNFCRGC---LHRNWAP 42 >BC011763-1|AAH11763.1| 294|Homo sapiens TRIM4 protein protein. Length = 294 Score = 40.7 bits (91), Expect = 0.003 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +1 Query: 88 IQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 ++A + LTCP+C F + P+S+ CGH CR C LHR P Sbjct: 1 MEAEDIQEELTCPICLDYF----QDPVSIECGHNFCRGC---LHRNWAP 42 >AF220024-1|AAG53478.1| 474|Homo sapiens tripartite motif protein TRIM4 isoform beta protein. Length = 474 Score = 40.7 bits (91), Expect = 0.003 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +1 Query: 88 IQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 ++A + LTCP+C F + P+S+ CGH CR C LHR P Sbjct: 1 MEAEDIQEELTCPICLDYF----QDPVSIECGHNFCRGC---LHRNWAP 42 >AF220023-1|AAG53477.1| 500|Homo sapiens tripartite motif protein TRIM4 isoform alpha protein. Length = 500 Score = 40.7 bits (91), Expect = 0.003 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +1 Query: 88 IQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 ++A + LTCP+C F + P+S+ CGH CR C LHR P Sbjct: 1 MEAEDIQEELTCPICLDYF----QDPVSIECGHNFCRGC---LHRNWAP 42 >AC011904-3|AAS07396.1| 294|Homo sapiens unknown protein. Length = 294 Score = 40.7 bits (91), Expect = 0.003 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +1 Query: 88 IQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 ++A + LTCP+C F + P+S+ CGH CR C LHR P Sbjct: 1 MEAEDIQEELTCPICLDYF----QDPVSIECGHNFCRGC---LHRNWAP 42 >AC011904-2|AAS07398.1| 474|Homo sapiens unknown protein. Length = 474 Score = 40.7 bits (91), Expect = 0.003 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +1 Query: 88 IQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 ++A + LTCP+C F + P+S+ CGH CR C LHR P Sbjct: 1 MEAEDIQEELTCPICLDYF----QDPVSIECGHNFCRGC---LHRNWAP 42 >AC011904-1|AAS07397.1| 500|Homo sapiens unknown protein. Length = 500 Score = 40.7 bits (91), Expect = 0.003 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +1 Query: 88 IQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 ++A + LTCP+C F + P+S+ CGH CR C LHR P Sbjct: 1 MEAEDIQEELTCPICLDYF----QDPVSIECGHNFCRGC---LHRNWAP 42 >AY081949-1|AAL91072.1| 486|Homo sapiens tripartite motif protein 50 isoform beta protein. Length = 486 Score = 40.3 bits (90), Expect = 0.004 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D+L CP+C F + P+ L CGH+ C+ CL+ L Sbjct: 12 DWLQCPICLEVF----KEPLMLQCGHSYCKGCLVSL 43 >AY081948-1|AAL91071.1| 487|Homo sapiens tripartite motif protein 50 isoform alpha protein. Length = 487 Score = 40.3 bits (90), Expect = 0.004 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 D+L CP+C F + P+ L CGH+ C+ CL+ L Sbjct: 12 DWLQCPICLEVF----KEPLMLQCGHSYCKGCLVSL 43 >U18543-1|AAA86474.1| 653|Homo sapiens zinc-finger protein protein. Length = 653 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL-----HRKQCPFDQTIIQL 258 + L CP+C P L CGHT+CR CL L + +CPF I ++ Sbjct: 16 EVLECPICMESITEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI 70 >BC024267-1|AAH24267.1| 594|Homo sapiens TRAF7 protein protein. Length = 594 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFD 240 L C +CC F + P+ +CGHT CR C L ++CP D Sbjct: 53 LCCQLCCSVF----KDPVITTCGHTFCRRCA--LKSEKCPVD 88 >AY569455-1|AAS68363.1| 670|Homo sapiens TRAF7 protein. Length = 670 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFD 240 L C +CC F + P+ +CGHT CR C L ++CP D Sbjct: 129 LCCQLCCSVF----KDPVITTCGHTFCRRCA--LKSEKCPVD 164 >DQ301480-1|ABC01033.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301479-1|ABC01032.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301478-1|ABC01031.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301477-1|ABC01030.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301475-1|ABC01028.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301474-1|ABC01027.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301473-1|ABC01026.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301472-1|ABC01025.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301471-1|ABC01024.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301470-1|ABC01023.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301469-1|ABC01022.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301464-1|ABC01017.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301462-1|ABC01015.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301457-1|ABC01010.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301455-1|ABC01008.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301454-1|ABC01007.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301453-1|ABC01006.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301451-1|ABC01004.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301450-1|ABC01003.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301449-1|ABC01002.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301448-1|ABC01001.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301447-1|ABC01000.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301446-1|ABC00999.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301445-1|ABC00998.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ301444-1|ABC00997.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >DQ288685-1|ABB90543.1| 493|Homo sapiens TRIM5alpha protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >BX255925-1|CAM24146.1| 261|Homo sapiens novel protein (DKFZp761H1710) protein. Length = 261 Score = 37.5 bits (83), Expect = 0.028 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 L CP C + R P LSC H++C CL L+ + CP Sbjct: 141 LECPTCGHSYNVTQRRPRVLSCLHSVCEQCLQILY-ESCP 179 >BC090061-1|AAH90061.1| 180|Homo sapiens hypothetical protein LOC727800 protein. Length = 180 Score = 37.5 bits (83), Expect = 0.028 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 L CP C + R P LSC H++C CL L+ + CP Sbjct: 60 LECPTCGHSYNVTQRRPRVLSCLHSVCEQCLQILY-ESCP 98 >BC021258-1|AAH21258.1| 347|Homo sapiens tripartite motif-containing 5 protein. Length = 347 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >BC020770-1|AAH20770.1| 219|Homo sapiens Unknown (protein for IMAGE:4733445) protein. Length = 219 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >BC016958-1|AAH16958.1| 180|Homo sapiens RNF208 protein protein. Length = 180 Score = 37.5 bits (83), Expect = 0.028 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 L CP C + R P LSC H++C CL L+ + CP Sbjct: 60 LECPTCGHSYNVTQRRPRVLSCLHSVCEQCLQILY-ESCP 98 >BC007372-1|AAH07372.1| 297|Homo sapiens tripartite motif-containing 52 protein. Length = 297 Score = 37.5 bits (83), Expect = 0.028 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +1 Query: 85 PIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQ 243 P+Q Q + C +C F + P+S+SCGH CR C+ L K+ DQ Sbjct: 10 PMQTLQ--EEAVCAICLDYF----KDPVSISCGHNFCRGCVTQLWSKEDEEDQ 56 >AY625000-1|AAT48101.1| 493|Homo sapiens TRIM5 alpha protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >AK054802-1|BAB70809.1| 297|Homo sapiens protein ( Homo sapiens cDNA FLJ30240 fis, clone BRACE2002091, weakly similar to ZINC-FINGER PROTEIN RFP. ). Length = 297 Score = 37.5 bits (83), Expect = 0.028 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +1 Query: 85 PIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQ 243 P+Q Q + C +C F + P+S+SCGH CR C+ L K+ DQ Sbjct: 10 PMQTLQ--EEAVCAICLDYF----KDPVSISCGHNFCRGCVTQLWSKEDEEDQ 56 >AK027593-1|BAB55218.1| 493|Homo sapiens protein ( Homo sapiens cDNA FLJ14687 fis, clone NT2RP2005003, weakly similar to 52 KD RO PROTEIN. ). Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >AF498999-1|AAP30736.1| 250|Homo sapiens tripartite motif protein TRIM50C protein. Length = 250 Score = 37.5 bits (83), Expect = 0.028 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 5/47 (10%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLI----HLHRK-QCP 234 D+L CP+C F + + L CGH+ C+ CL+ HL K +CP Sbjct: 12 DWLQCPICLEVF----KESLMLQCGHSYCKGCLVSLSYHLDTKVRCP 54 >AF416715-1|AAL16809.1| 180|Homo sapiens unknown protein. Length = 180 Score = 37.5 bits (83), Expect = 0.028 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCP 234 L CP C + R P LSC H++C CL L+ + CP Sbjct: 60 LECPTCGHSYNVTQRRPRVLSCLHSVCEQCLQILY-ESCP 98 >AF220029-1|AAG53483.1| 271|Homo sapiens tripartite motif protein TRIM5 isoform epsilon protein. Length = 271 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >AF220028-1|AAG53482.1| 326|Homo sapiens tripartite motif protein TRIM5 isoform delta protein. Length = 326 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >AF220027-1|AAG53481.1| 347|Homo sapiens tripartite motif protein TRIM5 isoform gamma protein. Length = 347 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >AF220026-1|AAG53480.1| 400|Homo sapiens tripartite motif protein TRIM5 isoform beta protein. Length = 400 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >AF220025-1|AAG53479.1| 493|Homo sapiens tripartite motif protein TRIM5 isoform alpha protein. Length = 493 Score = 37.5 bits (83), Expect = 0.028 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL H+K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANHKK 45 >AB209243-1|BAD92480.1| 311|Homo sapiens tripartite motif-containing 52 variant protein. Length = 311 Score = 37.5 bits (83), Expect = 0.028 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +1 Query: 85 PIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQ 243 P+Q Q + C +C F + P+S+SCGH CR C+ L K+ DQ Sbjct: 36 PMQTLQ--EEAVCAICLDYF----KDPVSISCGHNFCRGCVTQLWSKEDEEDQ 82 >L04510-1|AAA35940.1| 574|Homo sapiens nucleotide binding protein protein. Length = 574 Score = 37.1 bits (82), Expect = 0.036 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 115 LTCPVCCREFGAP-PRSPISLSCGHTLCRHCL--IHLHRK--QCPFDQTIIQL 258 L C VC F + P L CGHT+C CL + LH + +CPFD+ + L Sbjct: 29 LECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDL 81 >BC103890-1|AAI03891.1| 395|Homo sapiens NHL repeat containing 1 protein. Length = 395 Score = 37.1 bits (82), Expect = 0.036 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = +1 Query: 115 LTCPVCCREFG-APPRSPISLSCGHTLCRHCLIHL-HRK----QCPF 237 L C VC +FG R P +LSCGH +C C+ L H + +CPF Sbjct: 24 LECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPF 70 >BC103889-1|AAI03890.1| 395|Homo sapiens NHL repeat containing 1 protein. Length = 395 Score = 37.1 bits (82), Expect = 0.036 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = +1 Query: 115 LTCPVCCREFG-APPRSPISLSCGHTLCRHCLIHL-HRK----QCPF 237 L C VC +FG R P +LSCGH +C C+ L H + +CPF Sbjct: 24 LECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPF 70 >BC103888-1|AAI03889.1| 395|Homo sapiens NHL repeat containing 1 protein. Length = 395 Score = 37.1 bits (82), Expect = 0.036 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = +1 Query: 115 LTCPVCCREFG-APPRSPISLSCGHTLCRHCLIHL-HRK----QCPF 237 L C VC +FG R P +LSCGH +C C+ L H + +CPF Sbjct: 24 LECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPF 70 >BC022510-1|AAH22510.1| 574|Homo sapiens tripartite motif-containing 23 protein. Length = 574 Score = 37.1 bits (82), Expect = 0.036 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 115 LTCPVCCREFGAP-PRSPISLSCGHTLCRHCL--IHLHRK--QCPFDQTIIQL 258 L C VC F + P L CGHT+C CL + LH + +CPFD+ + L Sbjct: 29 LECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDL 81 >AY324850-1|AAQ19671.1| 395|Homo sapiens malin protein. Length = 395 Score = 37.1 bits (82), Expect = 0.036 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = +1 Query: 115 LTCPVCCREFG-APPRSPISLSCGHTLCRHCLIHL-HRK----QCPF 237 L C VC +FG R P +LSCGH +C C+ L H + +CPF Sbjct: 24 LECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPF 70 >AL589723-1|CAH71232.1| 395|Homo sapiens protein ( Human DNA sequence from clone RP11-204B7 on chromosome 6 Contains the TPMT gene for thiopurine S-methyltransferase, the gene for a ). Length = 395 Score = 37.1 bits (82), Expect = 0.036 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = +1 Query: 115 LTCPVCCREFG-APPRSPISLSCGHTLCRHCLIHL-HRK----QCPF 237 L C VC +FG R P +LSCGH +C C+ L H + +CPF Sbjct: 24 LECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPF 70 >AF230399-1|AAG50178.1| 546|Homo sapiens tripartite motif protein TRIM23 gamma protein. Length = 546 Score = 37.1 bits (82), Expect = 0.036 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 115 LTCPVCCREFGAP-PRSPISLSCGHTLCRHCL--IHLHRK--QCPFDQTIIQL 258 L C VC F + P L CGHT+C CL + LH + +CPFD+ + L Sbjct: 29 LECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDL 81 >AF230398-1|AAG50177.1| 569|Homo sapiens tripartite motif protein TRIM23 beta protein. Length = 569 Score = 37.1 bits (82), Expect = 0.036 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 115 LTCPVCCREFGAP-PRSPISLSCGHTLCRHCL--IHLHRK--QCPFDQTIIQL 258 L C VC F + P L CGHT+C CL + LH + +CPFD+ + L Sbjct: 29 LECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDL 81 >AF230397-1|AAG50176.1| 574|Homo sapiens tripartite motif protein TRIM23 alpha protein. Length = 574 Score = 37.1 bits (82), Expect = 0.036 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +1 Query: 115 LTCPVCCREFGAP-PRSPISLSCGHTLCRHCL--IHLHRK--QCPFDQTIIQL 258 L C VC F + P L CGHT+C CL + LH + +CPFD+ + L Sbjct: 29 LECGVCEDVFSLQGDKVPRLLLCGHTVCHDCLTRLPLHGRAIRCPFDRQVTDL 81 >AK027876-1|BAB55424.1| 488|Homo sapiens protein ( Homo sapiens cDNA FLJ14970 fis, clone THYRO1000501, weakly similar to 52 KD RO PROTEIN. ). Length = 488 Score = 36.3 bits (80), Expect = 0.064 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+LCR C+ Sbjct: 13 VTCPICLELL----TEPLSLDCGHSLCRACI 39 >AF220143-1|AAG53516.1| 488|Homo sapiens tripartite motif protein TRIM34 alpha protein. Length = 488 Score = 36.3 bits (80), Expect = 0.064 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+LCR C+ Sbjct: 13 VTCPICLELL----TEPLSLDCGHSLCRACI 39 >AB039904-1|BAB17051.1| 270|Homo sapiens interferon-responsive finger protein 1 short form protein. Length = 270 Score = 36.3 bits (80), Expect = 0.064 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+LCR C+ Sbjct: 13 VTCPICLELL----TEPLSLDCGHSLCRACI 39 >AB039903-1|BAB17050.1| 842|Homo sapiens interferon-responsive finger protein 1 long form protein. Length = 842 Score = 36.3 bits (80), Expect = 0.064 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+LCR C+ Sbjct: 367 VTCPICLELL----TEPLSLDCGHSLCRACI 393 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+S+ CGH+ C+ C+ Sbjct: 41 VTCPICLELL----TEPLSIDCGHSFCQACI 67 >AB039902-1|BAB17049.1| 488|Homo sapiens interferon-responsive finger protein 1 middle form protein. Length = 488 Score = 36.3 bits (80), Expect = 0.064 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+LCR C+ Sbjct: 13 VTCPICLELL----TEPLSLDCGHSLCRACI 39 >BC033871-1|AAH33871.1| 249|Homo sapiens TRIM74 protein protein. Length = 249 Score = 35.9 bits (79), Expect = 0.084 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLI----HLHRK-QCP 234 D L CP+C F + + L CGH+ C+ CL+ HL K +CP Sbjct: 12 DRLQCPICLEVF----KESLMLQCGHSYCKGCLVSLSYHLDTKVRCP 54 >BC033211-1|AAH33211.1| 269|Homo sapiens TRIM72 protein protein. Length = 269 Score = 35.9 bits (79), Expect = 0.084 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 L+CP+C + F AP ++ CGH+ CR CL Sbjct: 12 LSCPLCLQLFDAP----VTAECGHSFCRACL 38 >AK131485-1|BAD18630.1| 477|Homo sapiens protein ( Homo sapiens cDNA FLJ16664 fis, clone THYMU2006001, weakly similar to ZINC-BINDING PROTEIN A33. ). Length = 477 Score = 35.9 bits (79), Expect = 0.084 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 L+CP+C + F AP ++ CGH+ CR CL Sbjct: 12 LSCPLCLQLFDAP----VTAECGHSFCRACL 38 >AF498998-1|AAP30735.1| 250|Homo sapiens tripartite motif protein TRIM50B protein. Length = 250 Score = 35.9 bits (79), Expect = 0.084 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLI----HLHRK-QCP 234 D L CP+C F + + L CGH+ C+ CL+ HL K +CP Sbjct: 12 DRLQCPICLEVF----KESLMLQCGHSYCKGCLVSLSYHLDTKVRCP 54 >U13658-1|AAA79867.1| 475|Homo sapiens RO52 protein. Length = 475 Score = 35.5 bits (78), Expect = 0.11 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 103 WTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 W + +TCP+C F P+S+ CGH+ C+ C+ Sbjct: 11 WEE-VTCPICLDPFV----EPVSIECGHSFCQECI 40 >U01882-1|AAB87094.1| 475|Homo sapiens 52 kda component of SS-A/Ro autoantigen protein. Length = 475 Score = 35.5 bits (78), Expect = 0.11 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 103 WTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 W + +TCP+C F P+S+ CGH+ C+ C+ Sbjct: 11 WEE-VTCPICLDPFV----EPVSIECGHSFCQECI 40 >M62800-1|AAA36651.1| 475|Homo sapiens 52-kD SS-A/Ro autoantigen protein. Length = 475 Score = 35.5 bits (78), Expect = 0.11 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 103 WTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 W + +TCP+C F P+S+ CGH+ C+ C+ Sbjct: 11 WEE-VTCPICLDPFV----EPVSIECGHSFCQECI 40 >M34551-1|AAA36581.1| 475|Homo sapiens protein ( Human 52-kD ribonucleoprotein Ro/SSA mRNA, complete cds. ). Length = 475 Score = 35.5 bits (78), Expect = 0.11 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 103 WTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 W + +TCP+C F P+S+ CGH+ C+ C+ Sbjct: 11 WEE-VTCPICLDPFV----EPVSIECGHSFCQECI 40 >BC048194-1|AAH48194.1| 755|Homo sapiens tripartite motif-containing 56 protein. Length = 755 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 106 TDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL---HRKQCPFDQTIIQLNP 264 +D+L C +C + R+P +L C HT C+ CL L R +CP + + + P Sbjct: 16 SDFLACKICLEQL----RAPKTLPCLHTYCQDCLAQLADGGRVRCPECRETVPVPP 67 >BC013036-1|AAH13036.1| 192|Homo sapiens ring finger protein 183 protein. Length = 192 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCLIHL 216 CPVC F +P L C H+ C CL HL Sbjct: 13 CPVCWNPFNNTFHTPKMLDCCHSFCVECLAHL 44 >BC011882-1|AAH11882.1| 379|Homo sapiens TRIM56 protein protein. Length = 379 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 106 TDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL---HRKQCPFDQTIIQLNP 264 +D+L C +C + R+P +L C HT C+ CL L R +CP + + + P Sbjct: 87 SDFLACKICLEQL----RAPKTLPCLHTYCQDCLAQLADGGRVRCPECRETVPVPP 138 >BC010861-1|AAH10861.1| 475|Homo sapiens tripartite motif-containing 21 protein. Length = 475 Score = 35.5 bits (78), Expect = 0.11 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 103 WTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 W + +TCP+C F P+S+ CGH+ C+ C+ Sbjct: 11 WEE-VTCPICLDPFV----EPVSIECGHSFCQECI 40 >BC005847-1|AAH05847.3| 755|Homo sapiens tripartite motif-containing 56 protein. Length = 755 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 106 TDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL---HRKQCPFDQTIIQLNP 264 +D+L C +C + R+P +L C HT C+ CL L R +CP + + + P Sbjct: 16 SDFLACKICLEQL----RAPKTLPCLHTYCQDCLAQLADGGRVRCPECRETVPVPP 67 >BC001862-1|AAH01862.1| 208|Homo sapiens tripartite motif-containing 48 protein. Length = 208 Score = 35.5 bits (78), Expect = 0.11 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHC 204 LTCP+C F P+++ CGH+ CR C Sbjct: 13 LTCPICMNYF----IDPVTIDCGHSFCRPC 38 >AY742713-1|AAU89982.1| 475|Homo sapiens Sjogren syndrome antigen A1 protein. Length = 475 Score = 35.5 bits (78), Expect = 0.11 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 103 WTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 W + +TCP+C F P+S+ CGH+ C+ C+ Sbjct: 11 WEE-VTCPICLDPFV----EPVSIECGHSFCQECI 40 >AK092927-1|BAC04004.1| 269|Homo sapiens protein ( Homo sapiens cDNA FLJ35608 fis, clone SPLEN2009803. ). Length = 269 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 106 TDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL---HRKQCPFDQTIIQLNP 264 +D+L C +C + R+P +L C HT C+ CL L R +CP + + + P Sbjct: 16 SDFLACKICLEQL----RAPKTLPCLHTYCQDCLAQLADGGRVRCPECRETVPVPP 67 >AF521869-1|AAO14946.1| 375|Homo sapiens tripartite motif protein 48 protein. Length = 375 Score = 35.5 bits (78), Expect = 0.11 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHC 204 LTCP+C F P+++ CGH+ CR C Sbjct: 13 LTCPICMNYF----IDPVTIDCGHSFCRPC 38 >AF391283-1|AAK76432.1| 475|Homo sapiens SSA1 protein. Length = 475 Score = 35.5 bits (78), Expect = 0.11 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 103 WTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 W + +TCP+C F P+S+ CGH+ C+ C+ Sbjct: 11 WEE-VTCPICLDPFV----EPVSIECGHSFCQECI 40 >D87458-1|BAA13398.2| 711|Homo sapiens KIAA0282 protein. Length = 711 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +1 Query: 85 PIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHC 204 P+ + + L CPVC G+ R PI L C H LC+ C Sbjct: 45 PVPMEEMEEELKCPVC----GSFYREPIILPCSHNLCQAC 80 >DQ301458-1|ABC01011.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL ++K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANYKK 45 >DQ301456-1|ABC01009.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRK 225 +TCP+C P+SL CGH+ C+ CL ++K Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACLTANYKK 45 >BC132867-1|AAI32868.1| 511|Homo sapiens tripartite motif-containing 7 protein. Length = 511 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TC +C F R P+S+ CGH+ CR C+ Sbjct: 28 TCSICLELF----REPVSVECGHSFCRACI 53 >BC132863-1|AAI32864.1| 511|Homo sapiens tripartite motif-containing 7 protein. Length = 511 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TC +C F R P+S+ CGH+ CR C+ Sbjct: 28 TCSICLELF----REPVSVECGHSFCRACI 53 >BC080553-1|AAH80553.1| 221|Homo sapiens tripartite motif-containing 7 protein. Length = 221 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TC +C F R P+S+ CGH+ CR C+ Sbjct: 28 TCSICLELF----REPVSVECGHSFCRACI 53 >BC011567-1|AAH11567.1| 221|Homo sapiens tripartite motif-containing 7 protein. Length = 221 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TC +C F R P+S+ CGH+ CR C+ Sbjct: 28 TCSICLELF----REPVSVECGHSFCRACI 53 >AF396651-1|AAK85377.1| 511|Homo sapiens glycogenin-interacting protein 1 protein. Length = 511 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TC +C F R P+S+ CGH+ CR C+ Sbjct: 28 TCSICLELF----REPVSVECGHSFCRACI 53 >AF220032-1|AAG53486.1| 221|Homo sapiens tripartite motif protein TRIM7 protein. Length = 221 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TC +C F R P+S+ CGH+ CR C+ Sbjct: 28 TCSICLELF----REPVSVECGHSFCRACI 53 >Y07829-1|CAB52384.1| 481|Homo sapiens RING finger protein protein. Length = 481 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >BX005441-5|CAM26238.1| 481|Homo sapiens tripartite motif-containing 10 protein. Length = 481 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >BX005441-4|CAM26237.1| 395|Homo sapiens tripartite motif-containing 10 protein. Length = 395 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >BC126472-1|AAI26473.1| 452|Homo sapiens tripartite motif-containing 49 protein. Length = 452 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPF 237 L CP+C F P+++ CGH+ CR C +L+ + PF Sbjct: 13 LICPLCMNYF----IDPVTIDCGHSFCRPC-FYLNWQDIPF 48 >BC126470-1|AAI26471.1| 452|Homo sapiens tripartite motif-containing 49 protein. Length = 452 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPF 237 L CP+C F P+++ CGH+ CR C +L+ + PF Sbjct: 13 LICPLCMNYF----IDPVTIDCGHSFCRPC-FYLNWQDIPF 48 >BC113419-1|AAI13420.1| 395|Homo sapiens tripartite motif-containing 10 protein. Length = 395 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >BC093926-1|AAH93926.1| 395|Homo sapiens tripartite motif-containing 10 protein. Length = 395 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >BC075020-1|AAH75020.1| 452|Homo sapiens ring finger protein 18 protein. Length = 452 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPF 237 L CP+C F P+++ CGH+ CR C +L+ + PF Sbjct: 13 LICPLCMNYF----IDPVTIDCGHSFCRPC-FYLNWQDIPF 48 >BC075019-1|AAH75019.1| 452|Homo sapiens tripartite motif-containing 49 protein. Length = 452 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPF 237 L CP+C F P+++ CGH+ CR C +L+ + PF Sbjct: 13 LICPLCMNYF----IDPVTIDCGHSFCRPC-FYLNWQDIPF 48 >BA000025-88|BAB63332.1| 481|Homo sapiens RNF9 protein. Length = 481 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AL844220-2|CAI18610.1| 481|Homo sapiens tripartite motif-containing 10 protein. Length = 481 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AL844220-1|CAI18609.1| 395|Homo sapiens tripartite motif-containing 10 protein. Length = 395 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AL671859-11|CAI17587.1| 481|Homo sapiens tripartite motif-containing 10 protein. Length = 481 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AL671859-10|CAI17586.1| 395|Homo sapiens tripartite motif-containing 10 protein. Length = 395 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AL669914-11|CAI18188.1| 481|Homo sapiens tripartite motif-containing 10 protein. Length = 481 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AL669914-10|CAI18187.1| 395|Homo sapiens tripartite motif-containing 10 protein. Length = 395 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AF220123-1|AAG53496.1| 396|Homo sapiens tripartite motif protein TRIM10 beta protein. Length = 396 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AF220122-1|AAG53495.1| 482|Homo sapiens tripartite motif protein TRIM10 alpha protein. Length = 482 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AB202085-1|BAE78605.1| 481|Homo sapiens tripartite motif-containing 10 protein. Length = 481 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AB103595-1|BAF31256.1| 481|Homo sapiens Zn-finger protein protein. Length = 481 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AB088089-1|BAC54921.1| 481|Homo sapiens tripartite motif-containing 10 protein. Length = 481 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 D + CP+C R P+++ CGH CR CL Sbjct: 12 DEVNCPICQGTL----REPVTIDCGHNFCRACL 40 >AB037682-1|BAB03503.1| 452|Homo sapiens testis-specific RING Finger protein protein. Length = 452 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPF 237 L CP+C F P+++ CGH+ CR C +L+ + PF Sbjct: 13 LICPLCMNYF----IDPVTIDCGHSFCRPC-FYLNWQDIPF 48 >Y13667-1|CAA74018.1| 667|Homo sapiens putative transcription factor XPRF protein. Length = 667 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC +C + C ++++ Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFNCAHRILVSHCATNESV 48 >DQ232883-1|ABB18376.1| 500|Homo sapiens tripartite motif protein 69 protein. Length = 500 Score = 34.3 bits (75), Expect = 0.26 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQ-----CPFDQTIIQLN 261 L CP+C F R P+ LSCGH C C+ R Q CP + + Q N Sbjct: 39 LHCPLCNDWF----RDPLMLSCGHNFCEACIQDFWRLQAKETFCPECKMLCQYN 88 >BX537987-1|CAD97947.1| 323|Homo sapiens hypothetical protein protein. Length = 323 Score = 34.3 bits (75), Expect = 0.26 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+C F P L C HT CR+CL Sbjct: 8 LTCPICYSIF----EDPRVLPCSHTFCRNCL 34 >BC111956-1|AAI11957.1| 203|Homo sapiens ring finger protein 152 protein. Length = 203 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQ----CPFDQTIIQLNP 264 L C +C + +P R P L C HT C CL + Q CP+ + + +L P Sbjct: 10 LECQICFNYY-SPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKLPP 62 >BC109260-1|AAI09261.1| 403|Homo sapiens tripartite motif-containing 59 protein. Length = 403 Score = 34.3 bits (75), Expect = 0.26 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+C F P L C HT CR+CL Sbjct: 8 LTCPICYSIF----EDPRVLPCSHTFCRNCL 34 >BC109259-1|AAI09260.1| 403|Homo sapiens tripartite motif-containing 59 protein. Length = 403 Score = 34.3 bits (75), Expect = 0.26 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+C F P L C HT CR+CL Sbjct: 8 LTCPICYSIF----EDPRVLPCSHTFCRNCL 34 >BC094004-1|AAH94004.1| 203|Homo sapiens ring finger protein 152 protein. Length = 203 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQ----CPFDQTIIQLNP 264 L C +C + +P R P L C HT C CL + Q CP+ + + +L P Sbjct: 10 LECQICFNYY-SPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKLPP 62 >BC063407-1|AAH63407.1| 407|Homo sapiens tripartite motif-containing 13 protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >BC053671-1|AAH53671.1| 1056|Homo sapiens SH3RF1 protein protein. Length = 1056 Score = 34.3 bits (75), Expect = 0.26 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL----HRKQCPFDQTII 252 D L CPVC A + L C HT C+ CL+ + + +CP +T++ Sbjct: 8 DLLECPVCLERLDASAKV---LPCQHTFCKRCLLGIVGSRNELRCPECRTLV 56 >BC053626-1|AAH53626.1| 667|Homo sapiens midline 1 (Opitz/BBB syndrome) protein. Length = 667 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC +C + C ++++ Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFNCAHRILVSHCATNESV 48 >BC047945-1|AAH47945.1| 500|Homo sapiens tripartite motif-containing 69 protein. Length = 500 Score = 34.3 bits (75), Expect = 0.26 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQ-----CPFDQTIIQLN 261 L CP+C F R P+ LSCGH C C+ R Q CP + + Q N Sbjct: 39 LHCPLCNDWF----RDPLMLSCGHNFCEACIQDFWRLQAKETFCPECKMLCQYN 88 >BC024199-1|AAH24199.1| 503|Homo sapiens TRIM69 protein protein. Length = 503 Score = 34.3 bits (75), Expect = 0.26 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 5/54 (9%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQ-----CPFDQTIIQLN 261 L CP+C F R P+ LSCGH C C+ R Q CP + + Q N Sbjct: 39 LHCPLCNDWF----RDPLMLSCGHNFCEACIQDFWRLQAKETFCPECKMLCQYN 88 >BC003579-1|AAH03579.1| 407|Homo sapiens tripartite motif-containing 13 protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AY764035-1|AAV51406.1| 410|Homo sapiens candidate tumor suppressor RFP2 protein. Length = 410 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 11 LTCPICCSLFD----DPRVLPCSHNFCKKCL 37 >AY455758-1|AAR31110.1| 407|Homo sapiens leu5 protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AY191002-1|AAO38979.1| 407|Homo sapiens ret finger protein 2 transcript variant 1 protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AY159379-1|AAN86853.1| 403|Homo sapiens tumor suppressor TSBF1 protein. Length = 403 Score = 34.3 bits (75), Expect = 0.26 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+C F P L C HT CR+CL Sbjct: 8 LTCPICYSIF----EDPRVLPCSHTFCRNCL 34 >AY026763-1|AAK07687.1| 638|Homo sapiens gene overexpressed in astrocytoma protein. Length = 638 Score = 34.3 bits (75), Expect = 0.26 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +CP+C P R P++L CGH C CL Sbjct: 8 SCPICLE----PLREPVTLPCGHNFCLACL 33 >AL137060-3|CAC43391.1| 407|Homo sapiens tripartite motif-containing 13 protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AL137060-2|CAH72826.1| 266|Homo sapiens tripartite motif-containing 13 protein. Length = 266 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AL137060-1|CAH72825.1| 129|Homo sapiens tripartite motif-containing 13 protein. Length = 129 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AK096495-1|BAC04805.1| 203|Homo sapiens protein ( Homo sapiens cDNA FLJ39176 fis, clone OCBBF2003744, weakly similar to ZINC-FINGER PROTEIN HT2A. ). Length = 203 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQ----CPFDQTIIQLNP 264 L C +C + +P R P L C HT C CL + Q CP+ + + +L P Sbjct: 10 LECQICFNYY-SPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKLPP 62 >AK021429-1|BAB13822.1| 712|Homo sapiens protein ( Homo sapiens cDNA FLJ11367 fis, clone HEMBA1000303, highly similar to Mus musculus Plenty of SH3s (POSH) mRNA. ). Length = 712 Score = 34.3 bits (75), Expect = 0.26 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL----HRKQCPFDQTII 252 D L CPVC A + L C HT C+ CL+ + + +CP +T++ Sbjct: 8 DLLECPVCLERLDASAKV---LPCQHTFCKRCLLGIVGSRNELRCPECRTLV 56 >AJ224819-1|CAA12136.1| 407|Homo sapiens tumor suppressor protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AF279660-1|AAK13059.1| 407|Homo sapiens CAR protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AF269101-1|AAG33130.1| 667|Homo sapiens midline 1 protein. Length = 667 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC +C + C ++++ Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFNCAHRILVSHCATNESV 48 >AF241850-1|AAF91315.1| 407|Homo sapiens ret finger protein 2 protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AF241849-2|ABE41638.1| 407|Homo sapiens putative tumor suppressor RFP2 protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AF241849-1|AAK51624.1| 407|Homo sapiens putative tumor suppressor RFP2 protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AF230977-1|AAG50192.1| 552|Homo sapiens tripartite motif protein TRIM18 beta protein. Length = 552 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC +C + C ++++ Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFNCAHRILVSHCATNESV 48 >AF230976-1|AAG50191.1| 667|Homo sapiens tripartite motif protein TRIM18 alpha protein. Length = 667 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC +C + C ++++ Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFNCAHRILVSHCATNESV 48 >AF220128-1|AAG53501.1| 175|Homo sapiens tripartite motif protein TRIM13 beta protein. Length = 175 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AF220127-1|AAG53500.1| 407|Homo sapiens tripartite motif protein TRIM13 alpha protein. Length = 407 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 LTCP+CC F P L C H C+ CL Sbjct: 8 LTCPICCSLFD----DPRVLPCSHNFCKKCL 34 >AF041209-1|AAC33001.1| 667|Homo sapiens midline 1 fetal kidney isoform 2 protein. Length = 667 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC +C + C ++++ Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFNCAHRILVSHCATNESV 48 >AF041208-1|AAC33000.1| 667|Homo sapiens midline 1 fetal kidney isoform 1 protein. Length = 667 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC +C + C ++++ Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFNCAHRILVSHCATNESV 48 >AF041207-1|AAC32999.1| 228|Homo sapiens midline 1 cerebellar isoform 2 protein. Length = 228 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC +C + C ++++ Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFNCAHRILVSHCATNESV 48 >AF041206-1|AAC32998.1| 484|Homo sapiens midline 1 cerebellar isoform 1 protein. Length = 484 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC +C + C ++++ Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFNCAHRILVSHCATNESV 48 >AF035360-1|AAB99951.1| 667|Homo sapiens ring finger protein protein. Length = 667 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC +C + C ++++ Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFNCAHRILVSHCATNESV 48 >Z84476-1|CAI19959.1| 513|Homo sapiens ret finger protein protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >Z84474-1|CAB06480.2| 513|Homo sapiens ret finger protein protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >M16029-1|AAA36786.1| 805|Homo sapiens protein ( Human ret mRNA encoding a tyrosine kinase, partial cds. ). Length = 805 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 19 TCPVCLQYFA----EPMMLDCGHNICCACL 44 >J03407-1|AAA36564.1| 513|Homo sapiens protein ( Human rfp transforming protein mRNA, complete cds. ). Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >DQ301476-1|ABC01029.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ CL Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACL 39 >DQ301468-1|ABC01021.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ CL Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACL 39 >DQ301467-1|ABC01020.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ CL Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACL 39 >DQ301466-1|ABC01019.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ CL Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACL 39 >DQ301465-1|ABC01018.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ CL Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACL 39 >DQ301463-1|ABC01016.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ CL Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACL 39 >DQ301461-1|ABC01014.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ CL Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACL 39 >DQ301460-1|ABC01013.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ CL Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACL 39 >DQ301459-1|ABC01012.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ CL Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACL 39 >DQ301452-1|ABC01005.1| 493|Homo sapiens TRIM5 protein. Length = 493 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ CL Sbjct: 13 VTCPICLELL----TQPLSLDCGHSFCQACL 39 >BX537153-2|CAI18646.1| 513|Homo sapiens tripartite motif-containing 27 protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >BX537153-1|CAI18645.1| 358|Homo sapiens tripartite motif-containing 27 protein. Length = 358 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >BX119924-2|CAM26231.1| 513|Homo sapiens ret finger protein protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >BX119924-1|CAM26230.1| 358|Homo sapiens ret finger protein protein. Length = 358 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >BX005144-2|CAM25872.1| 513|Homo sapiens ret finger protein protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >BX005144-1|CAM25871.1| 358|Homo sapiens ret finger protein protein. Length = 358 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >BX000360-2|CAI18619.1| 513|Homo sapiens tripartite motif-containing 27 protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >BX000360-1|CAI18618.1| 358|Homo sapiens tripartite motif-containing 27 protein. Length = 358 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >BC103491-1|AAI03492.1| 718|Homo sapiens LON peptidase N-terminal domain and ring finger 3 protein. Length = 718 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 133 CREFGAPPRSPISLSCGHTLCRHCL 207 CR+ P+SLSCGHT C+ CL Sbjct: 158 CRKCHGFLSDPVSLSCGHTFCKLCL 182 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 76 IRMPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQCP 234 + +P+ + +D L C +C R F P +P CGHT C CL H +CP Sbjct: 412 LSLPLASFDASD-LECALCMRLFYEPVTTP----CGHTFCLKCLERCLDHNAKCP 461 >BC100986-1|AAI00987.1| 471|Homo sapiens TRIM60 protein protein. Length = 471 Score = 33.9 bits (74), Expect = 0.34 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +CP+C + P++++CGH CR CL Sbjct: 15 SCPICLEYL----KDPVTINCGHNFCRSCL 40 >BC100985-1|AAI00986.1| 471|Homo sapiens tripartite motif-containing 60 protein. Length = 471 Score = 33.9 bits (74), Expect = 0.34 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +CP+C + P++++CGH CR CL Sbjct: 15 SCPICLEYL----KDPVTINCGHNFCRSCL 40 >BC100984-1|AAI00985.1| 471|Homo sapiens tripartite motif-containing 60 protein. Length = 471 Score = 33.9 bits (74), Expect = 0.34 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +CP+C + P++++CGH CR CL Sbjct: 15 SCPICLEYL----KDPVTINCGHNFCRSCL 40 >BC100983-1|AAI00984.1| 471|Homo sapiens tripartite motif-containing 60 protein. Length = 471 Score = 33.9 bits (74), Expect = 0.34 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +CP+C + P++++CGH CR CL Sbjct: 15 SCPICLEYL----KDPVTINCGHNFCRSCL 40 >BC100671-1|AAI00672.1| 759|Homo sapiens LON peptidase N-terminal domain and ring finger 3 protein. Length = 759 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 133 CREFGAPPRSPISLSCGHTLCRHCL 207 CR+ P+SLSCGHT C+ CL Sbjct: 158 CRKCHGFLSDPVSLSCGHTFCKLCL 182 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 76 IRMPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQCP 234 + +P+ + +D L C +C R F P +P CGHT C CL H +CP Sbjct: 453 LSLPLASFDASD-LECALCMRLFYEPVTTP----CGHTFCLKCLERCLDHNAKCP 502 >BC099847-1|AAH99847.1| 759|Homo sapiens LON peptidase N-terminal domain and ring finger 3 protein. Length = 759 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 133 CREFGAPPRSPISLSCGHTLCRHCL 207 CR+ P+SLSCGHT C+ CL Sbjct: 158 CRKCHGFLSDPVSLSCGHTFCKLCL 182 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 76 IRMPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQCP 234 + +P+ + +D L C +C R F P +P CGHT C CL H +CP Sbjct: 453 LSLPLASFDASD-LECALCMRLFYEPVTTP----CGHTFCLKCLERCLDHNAKCP 502 >BC066924-1|AAH66924.1| 513|Homo sapiens tripartite motif-containing 27 protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >BC013580-1|AAH13580.1| 513|Homo sapiens tripartite motif-containing 27 protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >AL772284-3|CAI41520.1| 524|Homo sapiens LON peptidase N-terminal domain and ring finger 3 protein. Length = 524 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 76 IRMPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQCP 234 + +P+ + +D L C +C R F P +P CGHT C CL H +CP Sbjct: 218 LSLPLASFDASD-LECALCMRLFYEPVTTP----CGHTFCLKCLERCLDHNAKCP 267 >AL772284-2|CAI41519.1| 718|Homo sapiens LON peptidase N-terminal domain and ring finger 3 protein. Length = 718 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 133 CREFGAPPRSPISLSCGHTLCRHCL 207 CR+ P+SLSCGHT C+ CL Sbjct: 158 CRKCHGFLSDPVSLSCGHTFCKLCL 182 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 76 IRMPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQCP 234 + +P+ + +D L C +C R F P +P CGHT C CL H +CP Sbjct: 412 LSLPLASFDASD-LECALCMRLFYEPVTTP----CGHTFCLKCLERCLDHNAKCP 461 >AL662871-4|CAI18381.1| 513|Homo sapiens tripartite motif-containing 27 protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >AL662871-3|CAM25659.1| 358|Homo sapiens tripartite motif-containing 27 protein. Length = 358 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >AL662859-4|CAI17553.1| 513|Homo sapiens tripartite motif-containing 27 protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >AL662859-3|CAM24901.1| 358|Homo sapiens tripartite motif-containing 27 protein. Length = 358 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >AK131543-1|BAD18678.1| 205|Homo sapiens protein ( Homo sapiens cDNA FLJ16779 fis, clone BRHIP3038037. ). Length = 205 Score = 33.9 bits (74), Expect = 0.34 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = -1 Query: 399 PWCV*QCRTPACPTPGEP*YKAADTAAKVAHSPPAEAAPCSQPTPRVQLYDRLVEGALFP 220 PWC P CP G A A + PP P S P P Q R+ P Sbjct: 117 PWCPPIQEAPGCPALGPRPRSARSPRAAASTPPPPHPVPPSSPQPPAQPQPRVTAALRLP 176 >AK093201-1|BAC04093.1| 471|Homo sapiens protein ( Homo sapiens cDNA FLJ35882 fis, clone TESTI2008884, weakly similar to ZINC-FINGER PROTEIN RFP. ). Length = 471 Score = 33.9 bits (74), Expect = 0.34 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +CP+C + P++++CGH CR CL Sbjct: 15 SCPICLEYL----KDPVTINCGHNFCRSCL 40 >AK091777-1|BAC03744.1| 610|Homo sapiens protein ( Homo sapiens cDNA FLJ34458 fis, clone HLUNG2002811, weakly similar to Zinc finger protein. ). Length = 610 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 133 CREFGAPPRSPISLSCGHTLCRHCL 207 CR+ P+SLSCGHT C+ CL Sbjct: 158 CRKCHGFLSDPVSLSCGHTFCKLCL 182 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 76 IRMPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQCP 234 + +P+ + +D L C +C R F P +P CGHT C CL H +CP Sbjct: 453 LSLPLASFDASD-LECALCMRLFYEPVTTP----CGHTFCLKCLERCLDHNAKCP 502 >AK026265-1|BAB15419.1| 516|Homo sapiens protein ( Homo sapiens cDNA: FLJ22612 fis, clone HSI04965. ). Length = 516 Score = 33.9 bits (74), Expect = 0.34 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 76 IRMPIQAPQWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHL--HRKQCP 234 + +P+ + +D L C +C R F P +P CGHT C CL H +CP Sbjct: 210 LSLPLASFDASD-LECALCMRLFYEPVTTP----CGHTFCLKCLERCLDHNAKCP 259 >AF230394-1|AAG50173.1| 358|Homo sapiens tripartite motif protein TRIM27 beta protein. Length = 358 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >AF230393-1|AAG50172.1| 513|Homo sapiens tripartite motif protein TRIM27 alpha protein. Length = 513 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >AF171101-1|AAF32265.1| 47|Homo sapiens RFP transforming protein protein. Length = 47 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 15 TCPVCLQYFA----EPMMLDCGHNICCACL 40 >AB209885-1|BAD93122.1| 382|Homo sapiens ret finger protein isoform beta variant protein. Length = 382 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 TCPVC + F P+ L CGH +C CL Sbjct: 82 TCPVCLQYFA----EPMMLDCGHNICCACL 107 >BC050030-1|AAH50030.1| 247|Homo sapiens RNF182 protein protein. Length = 247 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 100 QWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 Q +D L C +C + R P L C H +C CL Sbjct: 13 QASDELECKICYNRYNLKQRKPKVLECCHRVCAKCL 48 >BC036755-1|AAH36755.1| 690|Homo sapiens ligand of numb-protein X 2 protein. Length = 690 Score = 33.5 bits (73), Expect = 0.45 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQ--CPFDQ 243 D L C +C + P P+ CGHT C CL + +++ CP D+ Sbjct: 46 DDLVCHICLQ----PLLQPLDTPCGHTFCYKCLRNFLQEKDFCPLDR 88 >BC030666-1|AAH30666.1| 247|Homo sapiens ring finger protein 182 protein. Length = 247 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 100 QWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 Q +D L C +C + R P L C H +C CL Sbjct: 13 QASDELECKICYNRYNLKQRKPKVLECCHRVCAKCL 48 >AL138699-1|CAH73446.1| 690|Homo sapiens ligand of numb-protein X 2 protein. Length = 690 Score = 33.5 bits (73), Expect = 0.45 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 109 DYLTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQ--CPFDQ 243 D L C +C + P P+ CGHT C CL + +++ CP D+ Sbjct: 46 DDLVCHICLQ----PLLQPLDTPCGHTFCYKCLRNFLQEKDFCPLDR 88 >AK090576-1|BAC03481.1| 247|Homo sapiens protein ( Homo sapiens cDNA FLJ33257 fis, clone ASTRO2005593. ). Length = 247 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 100 QWTDYLTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 Q +D L C +C + R P L C H +C CL Sbjct: 13 QASDELECKICYNRYNLKQRKPKVLECCHRVCAKCL 48 >Y18880-1|CAB56154.1| 715|Homo sapiens midline 2 protein protein. Length = 715 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC C + C ++I Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFSCAHRILVSSCSSGESI 48 >X82200-1|CAA57684.1| 442|Homo sapiens gpStaf50 protein. Length = 442 Score = 33.1 bits (72), Expect = 0.59 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ C+ Sbjct: 13 VTCPICLELL----TEPLSLDCGHSFCQACI 39 >BT006663-1|AAP35309.1| 685|Homo sapiens midline 2 protein. Length = 685 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC C + C ++I Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFSCAHRILVSSCSSGESI 48 >BC089393-1|AAH89393.1| 209|Homo sapiens tripartite motif-containing 61 protein. Length = 209 Score = 33.1 bits (72), Expect = 0.59 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCLI----HLHRK-QCPF 237 +CP+C + P+++SCGH C C+I LH CPF Sbjct: 15 SCPICLDYL----KDPVTISCGHNFCLSCIIMSWKDLHDSFPCPF 55 >BC035582-1|AAH35582.1| 498|Homo sapiens tripartite motif-containing 22 protein. Length = 498 Score = 33.1 bits (72), Expect = 0.59 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ C+ Sbjct: 13 VTCPICLELL----TEPLSLDCGHSFCQACI 39 >BC022281-1|AAH22281.1| 498|Homo sapiens tripartite motif-containing 22 protein. Length = 498 Score = 33.1 bits (72), Expect = 0.59 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 +TCP+C P+SL CGH+ C+ C+ Sbjct: 13 VTCPICLELL----TEPLSLDCGHSFCQACI 39 >BC017707-1|AAH17707.1| 685|Homo sapiens midline 2 protein. Length = 685 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC C + C ++I Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFSCAHRILVSSCSSGESI 48 >BC003054-1|AAH03054.1| 450|Homo sapiens bifunctional apoptosis regulator protein. Length = 450 Score = 33.1 bits (72), Expect = 0.59 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +1 Query: 160 SPISLSCGHTLCRHCL 207 +P +L+CGH+ CRHCL Sbjct: 43 NPTTLNCGHSFCRHCL 58 >AY625004-1|AAT48105.1| 685|Homo sapiens TRIM1 beta protein. Length = 685 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC C + C ++I Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFSCAHRILVSSCSSGESI 48 >AL109946-4|CAO72054.1| 685|Homo sapiens midline 2 protein. Length = 685 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC C + C ++I Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFSCAHRILVSSCSSGESI 48 >AL109946-3|CAO72053.1| 715|Homo sapiens midline 2 protein. Length = 715 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC C + C ++I Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFSCAHRILVSSCSSGESI 48 >AL109946-2|CAO72052.1| 219|Homo sapiens midline 2 protein. Length = 219 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC C + C ++I Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFSCAHRILVSSCSSGESI 48 >AL034399-3|CAI42074.1| 685|Homo sapiens midline 2 protein. Length = 685 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC C + C ++I Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFSCAHRILVSSCSSGESI 48 >AL034399-2|CAI42073.1| 715|Homo sapiens midline 2 protein. Length = 715 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC C + C ++I Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFSCAHRILVSSCSSGESI 48 >AF196481-1|AAF07341.1| 685|Homo sapiens RING finger protein protein. Length = 685 Score = 33.1 bits (72), Expect = 0.59 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 LTCP+C F P+ L C H+LC C + C ++I Sbjct: 8 LTCPICLELF----EDPLLLPCAHSLCFSCAHRILVSSCSSGESI 48 >AF173003-1|AAF59975.1| 450|Homo sapiens apoptosis regulator protein. Length = 450 Score = 33.1 bits (72), Expect = 0.59 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +1 Query: 160 SPISLSCGHTLCRHCL 207 +P +L+CGH+ CRHCL Sbjct: 43 NPTTLNCGHSFCRHCL 58 >Y07828-1|CAA69165.1| 236|Homo sapiens put. ring protein protein. Length = 236 Score = 32.7 bits (71), Expect = 0.78 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPF 237 CP+C + P+++ CGH C C+ + C F Sbjct: 16 CPICLDIL----QKPVTIDCGHNFCPQCITQIGETSCGF 50 >X58531-1|CAA41418.1| 2628|Homo sapiens laminin A chain protein. Length = 2628 Score = 32.7 bits (71), Expect = 0.78 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 118 TCPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPFDQTI 249 +C CC + P P ++S G+T C C H K C +D+++ Sbjct: 300 SCNRCCPGYHQQPWRPGTVSSGNT-CEACNCHNKAKDCYYDESV 342 >BC109063-1|AAI09064.1| 485|Homo sapiens tripartite motif-containing 68 protein. Length = 485 Score = 32.7 bits (71), Expect = 0.78 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 + CP+C R P+S+ CGH+ C CL Sbjct: 14 VACPICMTFL----REPMSIDCGHSFCHSCL 40 >BC075058-1|AAH75058.1| 485|Homo sapiens tripartite motif-containing 68 protein. Length = 485 Score = 32.7 bits (71), Expect = 0.78 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 + CP+C R P+S+ CGH+ C CL Sbjct: 14 VACPICMTFL----REPMSIDCGHSFCHSCL 40 >AF439153-1|AAL31641.1| 485|Homo sapiens Ro/SSA1 related protein FLJ10369 protein. Length = 485 Score = 32.7 bits (71), Expect = 0.78 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 + CP+C R P+S+ CGH+ C CL Sbjct: 14 VACPICMTFL----REPMSIDCGHSFCHSCL 40 >AF360739-1|AAL11501.1| 485|Homo sapiens SSA protein SS-56 protein. Length = 485 Score = 32.7 bits (71), Expect = 0.78 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 115 LTCPVCCREFGAPPRSPISLSCGHTLCRHCL 207 + CP+C R P+S+ CGH+ C CL Sbjct: 14 VACPICMTFL----REPMSIDCGHSFCHSCL 40 >AF230387-1|AAG50166.1| 267|Homo sapiens tripartite motif protein TRIM31 beta protein. Length = 267 Score = 32.7 bits (71), Expect = 0.78 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPF 237 CP+C + P+++ CGH C C+ + C F Sbjct: 16 CPICLDIL----QKPVTIDCGHNFCPQCITQIGETSCGF 50 >AF230386-1|AAG50165.1| 425|Homo sapiens tripartite motif protein TRIM31 alpha protein. Length = 425 Score = 32.7 bits (71), Expect = 0.78 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHRKQCPF 237 CP+C + P+++ CGH C C+ + C F Sbjct: 16 CPICLDIL----QKPVTIDCGHNFCPQCITQIGETSCGF 50 >U78798-1|AAB38751.1| 522|Homo sapiens putative interleukin 1 signal transducer protein. Length = 522 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +1 Query: 121 CPVCCREFGAPPRSPISLSCGHTLCRHCLIHLHR---KQCPFDQTIIQLN 261 CP+C R + CGH C+ C+I R +CP D I+ N Sbjct: 70 CPICLMAL----REAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLEN 115 >U69108-1|AAC51329.1| 538|Homo sapiens TNF receptor associated factor 5 protein. Length = 538 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Frame = +1 Query: 160 SPISLSCGHTLCRHCLIHLHRKQ----CPFDQTIIQ 255 +P CGH C+HC++ L CP D+ +I+ Sbjct: 35 NPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIK 70 >CR536557-1|CAG38794.1| 557|Homo sapiens TRAF5 protein. Length = 557 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Frame = +1 Query: 160 SPISLSCGHTLCRHCLIHLHRKQ----CPFDQTIIQ 255 +P CGH C+HC++ L CP D+ +I+ Sbjct: 54 NPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIK 89 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,550,364 Number of Sequences: 237096 Number of extensions: 1943074 Number of successful extensions: 11864 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 10839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11729 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4876707572 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -