BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0426 (753 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0295 - 32897545-32897805,32897859-32898714,32898843-32899096 29 4.0 08_02_1455 + 27230134-27231110,27231195-27231327,27231417-272315... 28 9.2 >03_06_0295 - 32897545-32897805,32897859-32898714,32898843-32899096 Length = 456 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 711 PTEGDPIRLVSVDGGFALLRRGRIRTCIP 625 P P+R +S D G + LRR ++R C+P Sbjct: 130 PVYSFPLRRISRDPGASRLRRLKLRNCLP 158 >08_02_1455 + 27230134-27231110,27231195-27231327,27231417-27231501, 27233372-27233571 Length = 464 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = -2 Query: 434 RTFRLSPNSPAGTPQSPTPLPRLLVIVRERAFAFVRVKATPLTSALPSA 288 R LSP P P+SPTPL A ++ R+ + A P A Sbjct: 12 RPHHLSPGQPPVVPRSPTPLDLSSAAAAAAAASYRRLSPSLRPPAHPQA 60 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,584,944 Number of Sequences: 37544 Number of extensions: 457835 Number of successful extensions: 1355 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1354 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2004270760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -