BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0426 (753 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75710-5|CAB54207.1| 240|Caenorhabditis elegans Hypothetical pr... 28 6.2 U40414-5|AAA81408.2| 339|Caenorhabditis elegans Hypothetical pr... 28 8.2 AC024826-15|AAF60790.1| 354|Caenorhabditis elegans Hypothetical... 28 8.2 >Z75710-5|CAB54207.1| 240|Caenorhabditis elegans Hypothetical protein D1081.9 protein. Length = 240 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +2 Query: 617 PSRGMQVLIRPRRSNAKPPSTETSLIGSPSVGAFRSHSVPLRL 745 PS+ + V R + +PP ++ S G PSV SH L L Sbjct: 156 PSQNLSVNKRRSNTRTEPPFSKISRTGPPSVMRKASHEFSLNL 198 >U40414-5|AAA81408.2| 339|Caenorhabditis elegans Hypothetical protein F53B3.5 protein. Length = 339 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 321 FNTYKGEGTFPYYNK 365 +NTY G G +PYYN+ Sbjct: 285 YNTYAGYGGYPYYNQ 299 >AC024826-15|AAF60790.1| 354|Caenorhabditis elegans Hypothetical protein Y55F3AM.13 protein. Length = 354 Score = 27.9 bits (59), Expect = 8.2 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Frame = +3 Query: 510 LAFRGYQNQQTSQSKNRCPP*NTRSNS-QLCPTIVLALQEECKFLSDRGGATQSRRRPKQ 686 ++F G QT + K+ + S QL T V +LQ K L G RRP+Q Sbjct: 217 VSFEGEVKNQTKEKKSSLKVVKGPAPSLQLEKTTVKSLQTIWKLLGSSLGLFS--RRPQQ 274 Query: 687 VLSDRPRSVXLG 722 VLS +++ LG Sbjct: 275 VLSASHQAIWLG 286 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,057,853 Number of Sequences: 27780 Number of extensions: 370557 Number of successful extensions: 1003 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1003 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1788025660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -