BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0423 (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 24 1.1 AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxyge... 23 3.5 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 3.5 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 3.5 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 22 4.6 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 8.0 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -2 Query: 415 SLSKCLNIIENSFRASSLTPEWFL-ACICCSRLCCMRIESWSSWSHC 278 +++KC ++ + S +TP FL C CC R +R E + +HC Sbjct: 55 AVNKCEGSCKSQVQPSVITPTGFLKECYCC-RESFLR-ERTITLTHC 99 >AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxygenase protein. Length = 76 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 356 GMVPGLYLLLEVVLHAHREL 297 GM+ G YL+L+ +L A R L Sbjct: 21 GMLYGEYLMLDKILEAQRLL 40 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 356 GMVPGLYLLLEVVLHAHREL 297 GM+ G YL+L+ +L A R L Sbjct: 21 GMLYGEYLMLDKILEAQRLL 40 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 356 GMVPGLYLLLEVVLHAHREL 297 GM+ G YL+L+ +L A R L Sbjct: 21 GMLYGEYLMLDKILEAQRLL 40 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 170 VLRTLVGAASPTVVPGNPCPPS 105 ++++LV + P VPG C P+ Sbjct: 319 IVQSLVNSMKPKEVPGPCCVPT 340 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -1 Query: 476 VVPEGSQTRLEL 441 VVPEGS+T +E+ Sbjct: 168 VVPEGSRTPIEI 179 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,939 Number of Sequences: 336 Number of extensions: 3711 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -