BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0416 (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 4.6 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 22 4.6 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 8.1 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 444 PNAKIMFCFTGKYHRQDVTNSIPERIE 524 PN K ++ TG+ Q +S ER++ Sbjct: 475 PNQKHIYYITGESKEQVANSSFVERVK 501 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.8 bits (44), Expect = 4.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 379 IRRIPHYKELLNDETQFYQF 438 ++R+ H K++L ETQ F Sbjct: 182 LQRVNHVKKILEKETQTVAF 201 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.0 bits (42), Expect = 8.1 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = +1 Query: 382 RRIPHYKELLNDETQFYQFFCQMPK*CFALXENIIVKTSLILFRN 516 +R+P + +LL ++ C F + V+T ILF N Sbjct: 374 KRLPGFDKLLREDQIALLKACSSEVMMFRMARRYDVQTDSILFVN 418 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,243 Number of Sequences: 336 Number of extensions: 2767 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -