BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0414 (840 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12B10.03 |||WD repeat protein, human WDR20 family|Schizosacc... 26 5.8 SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosacch... 26 7.6 >SPAC12B10.03 |||WD repeat protein, human WDR20 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 543 Score = 26.2 bits (55), Expect = 5.8 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 802 RGTYHKSHSYSKK*LPMLNLHKP 734 R + KSH++S P L LH+P Sbjct: 102 RNSKRKSHNFSSSNTPYLKLHRP 124 >SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2196 Score = 25.8 bits (54), Expect = 7.6 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 Query: 123 FK*GASTNNSRPKLAKSVQPFSSFSETNEHQFIF 22 F G N+ P+L +S++P+ S + + +FIF Sbjct: 909 FAIGCINVNAFPQLVRSLKPYISVLKQDHQEFIF 942 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,317,416 Number of Sequences: 5004 Number of extensions: 66026 Number of successful extensions: 138 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 414453330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -