BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0414 (840 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) 28 8.2 SB_11584| Best HMM Match : Peptidase_M28 (HMM E-Value=6.1e-11) 28 8.2 >SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) Length = 289 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 306 SIHSYNGCPTLQTETHYCFTAEISRVVVRTHEKQFRVLVNRKIKT 440 S++ P L + HYC + I VVR K+ +RKI+T Sbjct: 57 SVYEVYALPKLYVKLHYCVSCAIHSKVVRNRSKE-----DRKIRT 96 >SB_11584| Best HMM Match : Peptidase_M28 (HMM E-Value=6.1e-11) Length = 531 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = -2 Query: 350 RFSLKGGAAVVTMYTETLELISQGMWRIYVVDSMGSSNHLTQGGL 216 R S K GA V +Y++ E+ +G+ ++Y + + S +T+G + Sbjct: 198 RASQKNGAVGVILYSDPSEVACEGLDKVYPLYNWMPSTGVTRGNI 242 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,643,337 Number of Sequences: 59808 Number of extensions: 446043 Number of successful extensions: 724 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -