BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0413 (861 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC553.09c |spb70|pol12|DNA polymerase alpha B-subunit|Schizosa... 31 0.21 SPBC215.10 |||haloacid dehalogenase-like hydrolase|Schizosacchar... 27 3.4 SPCC1259.14c |meu27||S. pombe specific UPF0300 family protein 5|... 27 3.4 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 27 3.4 >SPCC553.09c |spb70|pol12|DNA polymerase alpha B-subunit|Schizosaccharomyces pombe|chr 3|||Manual Length = 574 Score = 31.1 bits (67), Expect = 0.21 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 671 LGIPL*LHTLPNTCLFSKQTVSSGQEVSDVLQHLNKTD 558 LG+P PN C+FS V G +D+L H ++ + Sbjct: 411 LGLPSNFKCFPNPCMFSINDVVFGVSTNDILLHTSREE 448 >SPBC215.10 |||haloacid dehalogenase-like hydrolase|Schizosaccharomyces pombe|chr 2|||Manual Length = 302 Score = 27.1 bits (57), Expect = 3.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 369 PGLNLRTLSTFGHHRNRLCMVKLTGY 292 P ++L + FG N +CM +L GY Sbjct: 234 PSISLENVLAFGDGANDVCMFELAGY 259 >SPCC1259.14c |meu27||S. pombe specific UPF0300 family protein 5|Schizosaccharomyces pombe|chr 3|||Manual Length = 736 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +3 Query: 399 EESIAKAVRYSNVVINLVGRDYETKNFKYND 491 +ESI+ + SN+ ++L R Y+TK K+N+ Sbjct: 166 KESISSSTN-SNIKLHLAARKYQTKPEKFNE 195 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 584 HPKPLVLKKPSAWKISKYLGECAVREEY 667 H P L +PSA ++ KYL E A + Y Sbjct: 4 HDPPAPLSQPSASRLQKYLLESAEKHAY 31 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,501,816 Number of Sequences: 5004 Number of extensions: 71389 Number of successful extensions: 159 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 159 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -