BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0413 (861 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1223 + 35033273-35033353,35033455-35033539,35033613-350336... 70 2e-12 11_03_0068 + 9564354-9565180,9566658-9568704 30 2.7 03_05_0714 - 27076881-27077218,27077332-27077482,27077768-270779... 30 2.7 11_06_0754 - 26935647-26937780,26940890-26941827 29 4.8 03_02_0592 - 9687700-9687933,9688515-9688591,9688891-9688999,968... 28 8.3 >02_05_1223 + 35033273-35033353,35033455-35033539,35033613-35033683, 35034400-35034531,35034654-35034769,35035128-35035251, 35035349-35035417,35035508-35035628,35035707-35035843 Length = 311 Score = 70.1 bits (164), Expect = 2e-12 Identities = 32/77 (41%), Positives = 54/77 (70%) Frame = +3 Query: 288 IGTQLILPYRGDFYDAQRLKVCGDLGQVLFTPYHLLDEESIAKAVRYSNVVINLVGRDYE 467 +G+Q+++P+RG + LK+ GDLGQ++ Y+ D +SI + SNVVINL+GR+YE Sbjct: 1 MGSQVLVPFRGSEDCHRHLKLMGDLGQIVPMKYNPRDVDSIKAVMAKSNVVINLIGREYE 60 Query: 468 TKNFKYNDVHVDGVEEL 518 T+N+ +++V+ E+L Sbjct: 61 TRNYGFDEVNHHMAEQL 77 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/62 (38%), Positives = 34/62 (54%) Frame = +2 Query: 539 GVERFIHLSYLNAEEHPKPLVLKKPSAWKISKYLGECAVREEYPTATIIRASDIYGSEDR 718 G+ RFI +S L A PS +K GE +V +E+P ATI+R + + G+EDR Sbjct: 86 GIMRFIQVSSLGASA-------SSPSRMLRAKAAGEESVLKEFPEATIMRPATMIGTEDR 138 Query: 719 FL 724 L Sbjct: 139 IL 140 >11_03_0068 + 9564354-9565180,9566658-9568704 Length = 957 Score = 29.9 bits (64), Expect = 2.7 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 2/84 (2%) Frame = +3 Query: 303 ILPYRGDFYDAQRLKVCGDLGQV-LFTPYHLLDEESIAKAVRYSNVVINLVGRDYETKNF 479 ILP A+ L V G + L + +H+L +I + N + +GR ++ K Sbjct: 548 ILPATMVLSSARSLVVYGSTEHIPLISAFHVLRTIAIESNDKLKNCYLRDIGRLFQLKCL 607 Query: 480 KYNDVHVDGVEELPES-AEKKELR 548 + +V G+ ELPE E +EL+ Sbjct: 608 RLREV---GISELPEEIGELQELQ 628 >03_05_0714 - 27076881-27077218,27077332-27077482,27077768-27077903, 27078309-27078457,27079141-27079267,27080033-27080172, 27080264-27080329,27080760-27080901,27081021-27081115, 27081640-27082140 Length = 614 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 172 NLAAYKRGTGGRSSFNGIVATVFGCTGLSDAMCATNWEKLVPS*FYHTEAIS 327 NLA +K +S NG++ATV L D C T +L+ + F ++S Sbjct: 277 NLACHKSLANAITSHNGLIATVVDQLFLDDPGCLTETFRLLSTIFQSNASMS 328 >11_06_0754 - 26935647-26937780,26940890-26941827 Length = 1023 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 536 EGVERFIHLSYLNAEEHPKPLVL 604 EG+++ + LSY N EH KP VL Sbjct: 446 EGIKQVLDLSYNNLSEHLKPCVL 468 >03_02_0592 - 9687700-9687933,9688515-9688591,9688891-9688999, 9689162-9689260,9689368-9689454,9689570-9689630, 9689739-9689813,9689936-9689961 Length = 255 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 480 KYNDVHVDGVEELPESAEKKELRDSFI 560 KY D H +G LPE EK++ D I Sbjct: 102 KYIDSHFEGPALLPEDPEKRQFADELI 128 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,175,256 Number of Sequences: 37544 Number of extensions: 446795 Number of successful extensions: 1018 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 995 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1018 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -