BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0412 (773 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 25 2.6 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 7.9 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -1 Query: 710 SNYFWFKLVPQPVPWLVVHPFHFLQGHGRR 621 +N+F+FK Q V L +H FH + R Sbjct: 275 ANHFFFKKDYQKVQHLALHAFHNTENEAMR 304 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.4 bits (48), Expect = 7.9 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +2 Query: 584 PRDQRWDVVV---DLFFYRDPEESEKDEQQAKEQAVVP 688 P+ Q W VV +R P++ ++ +QQ E+ V P Sbjct: 230 PQQQLWTTVVRGRPSQRHRQPQQQQQQQQQQGERYVPP 267 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 892,451 Number of Sequences: 2352 Number of extensions: 20448 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -