BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0411 (838 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0292 + 27581862-27581913,27582395-27582615,27582691-275830... 29 6.1 12_02_0391 - 18533427-18533620,18534120-18534405,18534967-185350... 28 8.0 >02_05_0292 + 27581862-27581913,27582395-27582615,27582691-27583087, 27583645-27583730,27584229-27584292,27584395-27584507, 27584998-27585036,27585037-27585177 Length = 370 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 748 GWTSSSPPGVKW-VPEPIDIYNVNAAT 825 GW+ SSPP KW + +D+ V AT Sbjct: 178 GWSDSSPPKAKWDRAKNVDVLGVELAT 204 >12_02_0391 - 18533427-18533620,18534120-18534405,18534967-18535028, 18535526-18535613 Length = 209 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/55 (25%), Positives = 30/55 (54%) Frame = -1 Query: 586 WIIKNNKIMNLFKGHSVTTMIQKYLILCYIACRLHLQQCNAIINEPTRGVIALGR 422 WI++N + + + ++ + K ++LC +AC + L++ N RG+ +GR Sbjct: 98 WILQNQQDNGSWGINPSSSSVDKDILLCTLACVVALKRWNVGPYHIKRGLNFIGR 152 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,233,320 Number of Sequences: 37544 Number of extensions: 302689 Number of successful extensions: 615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2315199948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -