BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0410 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 24 5.8 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 24 5.8 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 23.8 bits (49), Expect = 5.8 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = -1 Query: 441 LRCYLLTQILEVETHHTVELQILIGFAEREQIEPVGVPLVYHVAKRFTLQHTL 283 LR +T+ EVE ++ + I + +++ + V LV + K+F+ +H + Sbjct: 39 LRDLYITRAREVEFNNKKAIIIYVPVPKQKAFQKVQTRLVRELEKKFSGKHVV 91 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 23.8 bits (49), Expect = 5.8 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +2 Query: 206 CQWTSSHEYPALKNWTYAVTRWTQRTSVCWSVKR 307 C W + P+ T RW + + CW +R Sbjct: 5 CAWRCARASPSRPILTTRGRRWPRPPTSCWPSRR 38 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,431 Number of Sequences: 2352 Number of extensions: 13387 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -