BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0410 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 26 0.44 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 23 4.1 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 22 5.4 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.4 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 25.8 bits (54), Expect = 0.44 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = -3 Query: 211 LTAVSVAKIYAILSSNIFKCKHNHFFT*SNNKNTRTITSKTFL*YKTFNYKYFREPVN 38 L +S KI +SSNI++ ++N + +NK + L + N++ PVN Sbjct: 348 LQFISGIKIIKQISSNIYERQNNEYIWIVSNKYQKIANGD--LNFNEVNFRILNAPVN 403 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 221 SHEYPALKNWTYAVTRWTQRTSV 289 S E+ KN+ + V RW +T V Sbjct: 62 SGEFDHTKNYPFDVDRWRDKTFV 84 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 645 RFLLKCLTNNEASVIGSDKGDQNFKXKL 728 R ++ L+NN S I + D N+ KL Sbjct: 79 RKIISSLSNNYISNISNYNNDNNYNKKL 106 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -3 Query: 328 IGVSCCEALHAPTYACPLG 272 IGV A PTY C LG Sbjct: 644 IGVLTLVATSMPTYICYLG 662 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,076 Number of Sequences: 438 Number of extensions: 3384 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -