SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= e96h0409
         (853 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein.             25   2.9  
DQ080909-1|AAY89555.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080908-1|AAY89554.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080907-1|AAY89553.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080906-1|AAY89552.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080905-1|AAY89551.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080904-1|AAY89550.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080903-1|AAY89549.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080902-1|AAY89548.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080901-1|AAY89547.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080900-1|AAY89546.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080899-1|AAY89545.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080898-1|AAY89544.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080897-1|AAY89543.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080896-1|AAY89542.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080894-1|AAY89540.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080893-1|AAY89539.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080892-1|AAY89538.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080891-1|AAY89537.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080890-1|AAY89536.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080889-1|AAY89535.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080888-1|AAY89534.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080887-1|AAY89533.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080886-1|AAY89532.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080885-1|AAY89531.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080884-1|AAY89530.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080883-1|AAY89529.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080882-1|AAY89528.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080881-1|AAY89527.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080880-1|AAY89526.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080879-1|AAY89525.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080878-1|AAY89524.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080877-1|AAY89523.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080876-1|AAY89522.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080875-1|AAY89521.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080874-1|AAY89520.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080873-1|AAY89519.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080872-1|AAY89518.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080871-1|AAY89517.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080870-1|AAY89516.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080869-1|AAY89515.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080868-1|AAY89514.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080867-1|AAY89513.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080866-1|AAY89512.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080865-1|AAY89511.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080864-1|AAY89510.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080863-1|AAY89509.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
DQ080862-1|AAY89508.1|  120|Anopheles gambiae olfactory receptor...    24   5.1  
AY183375-1|AAO24765.1|  679|Anopheles gambiae NADPH cytochrome P...    23   8.9  

>X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein.
          Length = 1231

 Score = 25.0 bits (52), Expect = 2.9
 Identities = 11/25 (44%), Positives = 13/25 (52%)
 Frame = +1

Query: 703  GRVIATKVDFG*KSPFTNPCCTGIG 777
            G+V  TK  FG   P T  C  G+G
Sbjct: 1144 GQVHKTKEQFGQDGPITVHCSAGVG 1168


>DQ080909-1|AAY89555.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080908-1|AAY89554.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080907-1|AAY89553.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080906-1|AAY89552.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080905-1|AAY89551.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080904-1|AAY89550.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080903-1|AAY89549.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080902-1|AAY89548.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080901-1|AAY89547.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080900-1|AAY89546.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080899-1|AAY89545.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080898-1|AAY89544.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080897-1|AAY89543.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080896-1|AAY89542.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080894-1|AAY89540.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080893-1|AAY89539.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080892-1|AAY89538.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080891-1|AAY89537.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080890-1|AAY89536.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080889-1|AAY89535.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080888-1|AAY89534.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080887-1|AAY89533.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080886-1|AAY89532.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080885-1|AAY89531.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080884-1|AAY89530.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080883-1|AAY89529.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080882-1|AAY89528.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080881-1|AAY89527.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080880-1|AAY89526.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080879-1|AAY89525.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080878-1|AAY89524.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080877-1|AAY89523.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080876-1|AAY89522.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080875-1|AAY89521.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080874-1|AAY89520.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080873-1|AAY89519.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080872-1|AAY89518.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080871-1|AAY89517.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080870-1|AAY89516.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080869-1|AAY89515.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080868-1|AAY89514.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080867-1|AAY89513.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080866-1|AAY89512.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080865-1|AAY89511.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080864-1|AAY89510.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080863-1|AAY89509.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>DQ080862-1|AAY89508.1|  120|Anopheles gambiae olfactory receptor 38
           protein.
          Length = 120

 Score = 24.2 bits (50), Expect = 5.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -2

Query: 849 GIWSPNQLTRQW 814
           G W P++LTR+W
Sbjct: 33  GCWPPDRLTRRW 44


>AY183375-1|AAO24765.1|  679|Anopheles gambiae NADPH cytochrome P450
           reductase protein.
          Length = 679

 Score = 23.4 bits (48), Expect = 8.9
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = -3

Query: 581 DTSSLTKIPGKHPTAPNTCPTSLSDGTALVRSSFLRQ 471
           DT S  K P   PT   T  T   + TAL R+  L++
Sbjct: 355 DTDSSKKHPFPCPTTYRTALTHYLEITALPRTHILKE 391


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 943,261
Number of Sequences: 2352
Number of extensions: 21179
Number of successful extensions: 66
Number of sequences better than 10.0: 49
Number of HSP's better than 10.0 without gapping: 66
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 66
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 90545769
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -