BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0408 (840 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28770.1 68416.m03591 expressed protein 31 0.72 At3g06910.1 68416.m00820 Ulp1 protease family protein similar to... 31 0.72 At5g10950.1 68418.m01271 cylicin-related low similarity to SP|Q2... 31 1.3 At4g03565.1 68417.m00490 expressed protein 29 3.8 At3g59050.1 68416.m06582 amine oxidase family protein similar to... 29 3.8 At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding famil... 28 6.7 At5g03740.1 68418.m00335 zinc finger (C2H2 type) family protein ... 28 8.9 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 31.5 bits (68), Expect = 0.72 Identities = 19/63 (30%), Positives = 33/63 (52%) Frame = +1 Query: 304 NIDSSCEDAGENNADEKEGNGGKITNQPLRSNDNSSELYTICVDEDLGTEESTKIFNDDI 483 N D + E +GE+N ++KE + + + N+N VD ++G +E +K DD Sbjct: 812 NRDEAKERSGEDNKEDKEESKDYQSVEAKEKNENGG------VDTNVGNKEDSKDLKDDR 865 Query: 484 SVD 492 SV+ Sbjct: 866 SVE 868 >At3g06910.1 68416.m00820 Ulp1 protease family protein similar to sentrin/SUMO-specific protease [Homo sapiens] GI:6906859; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 502 Score = 31.5 bits (68), Expect = 0.72 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +3 Query: 546 LVSVQFRDKKLA--SSYKQKVKAFMLKLIKIHNDDALEGSECETDLELDIWPEDVVEELP 719 L + +D+K S+K + + L + D+ + SE DL++ W ++ V++LP Sbjct: 396 LAVINIKDQKFQYLDSFKGREPKILDALARYFVDEVRDKSE--VDLDVSRWRQEFVQDLP 453 Query: 720 KPRGSEDC 743 R DC Sbjct: 454 MQRNGFDC 461 >At5g10950.1 68418.m01271 cylicin-related low similarity to SP|Q28092 Cylicin II (Multiple-band polypeptide II) {Bos taurus} Length = 395 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +1 Query: 283 ETPVDVINIDSSCEDAGENNA--DEKEGNGGKITNQPLRSNDNSSE 414 E + + +S D GENN+ DEKE KIT++ ++SN E Sbjct: 286 EAEPKALKLSNSNSDNGENNSSDDEKEITISKITSKKIKSNTADEE 331 >At4g03565.1 68417.m00490 expressed protein Length = 263 Score = 29.1 bits (62), Expect = 3.8 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +1 Query: 310 DSSCEDAGENNADEKEGNGGKITNQPLRSNDNSSELYT-IC-VDEDLGTEE 456 + E GE+N D +G +QP DN +LY+ C DED T+E Sbjct: 75 EGDTEREGEDNGDSIVDDGYSTNDQPEWEVDNFDDLYSDFCSPDEDCYTDE 125 >At3g59050.1 68416.m06582 amine oxidase family protein similar to polyamine oxidase (EC 1.5.3.11) precursor - Zea mays [SP|O64411]; contains Pfam profile PF01593 amine oxidase, flavin-containing Length = 488 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 707 NNIFWPNVKF*VCLTF*TF*CIVIMNLYK 621 +N+FWPNV+F + ++ C +NL+K Sbjct: 316 DNVFWPNVEFLGVVAETSYGCSYFLNLHK 344 >At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 2228 Score = 28.3 bits (60), Expect = 6.7 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 322 EDAGENNADEKEGNGGKITNQPLRSNDNSSELYTICVDEDLGTEESTKIFNDDISV 489 + AGEN D E NG L S V +D TE + KI DDI++ Sbjct: 1163 DSAGENKKDTAESNGNLDVIMDLESKSRKKGGGLGDVYQDKCTEGNGKIVWDDIAI 1218 >At5g03740.1 68418.m00335 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 287 Score = 27.9 bits (59), Expect = 8.9 Identities = 21/61 (34%), Positives = 31/61 (50%) Frame = +1 Query: 280 QETPVDVINIDSSCEDAGENNADEKEGNGGKITNQPLRSNDNSSELYTICVDEDLGTEES 459 Q+ D DSS +D EN+ DE+E K+T + D+SS+ +ED +EE Sbjct: 131 QDDDADGSEEDSSDDDDSENSGDEEE---EKVTAESDSEEDDSSD-----DEEDDSSEEE 182 Query: 460 T 462 T Sbjct: 183 T 183 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,379,555 Number of Sequences: 28952 Number of extensions: 267054 Number of successful extensions: 696 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1941125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -