BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0404 (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 23 2.2 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 2.2 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 22 3.9 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 22 3.9 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 120 LQTSAMKIRVRSSREPSQSFHRVCTGSPVRAATSIL 227 + T+A IRV S +EP+ F+ + +A IL Sbjct: 139 IATAAFGIRVNSVQEPNNEFYAMGRSLTTFSAFQIL 174 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +2 Query: 71 LIGN--LVQGSHVFGNLIPPNI 130 L+GN LV H FG + PN+ Sbjct: 99 LLGNHQLVYNCHTFGRFLAPNL 120 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 134 NEDQSQKFKGALAEFSSRLYRVAGQSSNFH 223 N + KFK F + Y+V G FH Sbjct: 143 NGTEVAKFKNMWTRFQLKYYQVTGTPIIFH 172 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 22.2 bits (45), Expect = 3.9 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 134 NEDQSQKFKGALAEFSSRLYRVAGQSSNFH 223 N + KFK F + Y+V G FH Sbjct: 143 NGTEVAKFKNMWTRFQLKYYQVTGTPIIFH 172 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,288 Number of Sequences: 336 Number of extensions: 3379 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -