BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0402 (738 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0248 + 15798650-15799075,15799143-15799619,15799713-15800948 29 5.1 02_05_1205 + 34939062-34939919 29 5.1 >07_03_0248 + 15798650-15799075,15799143-15799619,15799713-15800948 Length = 712 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +1 Query: 226 AIKYILNHVLMSIISILNKSISVKNRMFNFGTIRGYKKRACRTKLPLSLLYA 381 +++Y+LN + + + +V + F + GY++R KL L LL+A Sbjct: 19 SVRYLLNQIGSDRTTHIQILATVGGALLGFQALLGYRRRRSSNKLFLVLLWA 70 >02_05_1205 + 34939062-34939919 Length = 285 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 315 RYYTRIQEACVQDETTAFVAIRGAPRARGSDAIL 416 R+ R++EA ++ +T A APR G DA+L Sbjct: 80 RFLFRVEEAFLRSDTAAVTVEVRAPRRFGGDAVL 113 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,110,553 Number of Sequences: 37544 Number of extensions: 294254 Number of successful extensions: 637 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -