BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0402 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS... 23 9.8 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 9.8 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 9.8 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 9.8 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 9.8 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 9.8 >Z69977-1|CAA93817.1| 151|Anopheles gambiae ribosomal protein RS11 protein. Length = 151 Score = 23.0 bits (47), Expect = 9.8 Identities = 5/16 (31%), Positives = 12/16 (75%) Frame = +3 Query: 213 KKRKSYKIHIKPCFNE 260 K+ ++ ++H+ PCF + Sbjct: 97 KRNRNMRLHLSPCFRD 112 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 442 SFPLEPHYFKIASEPRARGAPRIATKAVVSSCT 344 S P PH+ + P + +AT + V +CT Sbjct: 11 SAPSPPHHHHSSQSPTSTTTVTMATASPVPACT 43 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 442 SFPLEPHYFKIASEPRARGAPRIATKAVVSSCT 344 S P PH+ + P + +AT + V +CT Sbjct: 11 SAPSPPHHHHSSQSPTSTTTVTMATASPVPACT 43 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 354 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 383 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.0 bits (47), Expect = 9.8 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 323 YADTRSVRAGRNYRFRCYTRCPARPRFRCNFE 418 YADT R G NY CP R R NF+ Sbjct: 338 YADTHRHRVGANY-LMLPVNCPYRVATR-NFQ 367 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,433 Number of Sequences: 2352 Number of extensions: 13796 Number of successful extensions: 30 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -