BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0399 (757 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31090| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_40832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 >SB_31090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 502 Score = 32.3 bits (70), Expect = 0.44 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +3 Query: 537 VSIDCKSIGVESSEGIRNYPASVAIVNEDKICVYNAVINP 656 ++IDC+ +GV SEG ++ A V+IVN VY+ + P Sbjct: 122 IAIDCEFVGV-GSEGAKHMLARVSIVNSHGRVVYDKYVAP 160 >SB_40832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1496 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Frame = +3 Query: 537 VSIDCKSIGVE------SSEGIRNYPASVAIVNEDKICVYNAVINPRNLQVC 674 VSI+C + GV S +G+R YP ++ + + NA ++ C Sbjct: 196 VSIECNATGVPRPEVFWSKDGLRLYPGEYPVLENKTLIITNAKVDDSGYYTC 247 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,031,378 Number of Sequences: 59808 Number of extensions: 337544 Number of successful extensions: 654 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -