BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0399 (757 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016683-3|AAB66193.1| 497|Caenorhabditis elegans Hypothetical ... 28 8.2 AC006664-1|AAF39902.2| 298|Caenorhabditis elegans Serpentine re... 28 8.2 >AF016683-3|AAB66193.1| 497|Caenorhabditis elegans Hypothetical protein K09F6.2 protein. Length = 497 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -2 Query: 240 NSKSKLIYFYFFFSFSTVRIYL*FNEYVF 154 NS SKL++F FFF FS + F ++F Sbjct: 468 NSLSKLVFFCFFFHFSLNVFFCCFVIFLF 496 >AC006664-1|AAF39902.2| 298|Caenorhabditis elegans Serpentine receptor, class bc (class b-like) protein 40 protein. Length = 298 Score = 27.9 bits (59), Expect = 8.2 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = -3 Query: 644 SVINAYLVLVYDSHRRGVISDT---FRGFHTD 558 SVIN YLVL++ S RR S+ F FH D Sbjct: 19 SVINVYLVLMFRSQRRHQTSELTQFFYRFHLD 50 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,719,573 Number of Sequences: 27780 Number of extensions: 280152 Number of successful extensions: 646 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1798543458 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -