BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0398 (738 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16470| Best HMM Match : EGF (HMM E-Value=1.7e-06) 29 5.2 SB_2596| Best HMM Match : Extensin_2 (HMM E-Value=0.083) 28 6.9 SB_37218| Best HMM Match : Keratin_B2 (HMM E-Value=4) 28 9.1 SB_26664| Best HMM Match : I-set (HMM E-Value=7.6e-06) 28 9.1 SB_2871| Best HMM Match : TSP_C (HMM E-Value=8e-11) 28 9.1 >SB_16470| Best HMM Match : EGF (HMM E-Value=1.7e-06) Length = 484 Score = 28.7 bits (61), Expect = 5.2 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 4/42 (9%) Frame = +1 Query: 547 LLTDG--RLRHLIYHKHIADSMKEDIQYSGTFS--LHGNIPI 660 + T+G RL HLI H+ + + I+ SGT S ++GNIPI Sbjct: 300 MATEGKTRLNHLIKHQKYEEVVYHLIRNSGTSSYIVNGNIPI 341 >SB_2596| Best HMM Match : Extensin_2 (HMM E-Value=0.083) Length = 896 Score = 28.3 bits (60), Expect = 6.9 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +2 Query: 320 YAVRINKCCEHNEIMVDFVCRLAVNYNQSVWEPHFKTEDGQDGKVKYYNY 469 Y V+I KCC + + VC A + P +T DG+ K YNY Sbjct: 484 YNVKIQKCCFGRVVPLRTVCEKAFTCGHRSYNP--RTSRCCDGR-KVYNY 530 >SB_37218| Best HMM Match : Keratin_B2 (HMM E-Value=4) Length = 181 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -2 Query: 503 TV*PHSLVIHMCNCNISPFH-LVHLRF*NVAPI 408 +V P +V+HMC ++ PF +VH+ +V P+ Sbjct: 145 SVKPFGVVVHMCRVSVKPFGVVVHMCRVSVKPV 177 >SB_26664| Best HMM Match : I-set (HMM E-Value=7.6e-06) Length = 434 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 135 QAFQRDNKLLFRSLTKIDN*ISVLRNADTMYLLIVFTLLV 254 +AF RD+ LL S K D+ + + R ++ + + VFT LV Sbjct: 266 RAFVRDDSLLISSTRKADSGMYICRASNDLGVTEVFTQLV 305 >SB_2871| Best HMM Match : TSP_C (HMM E-Value=8e-11) Length = 326 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 523 GDSEDKLNLLTDGRLRHL---IYHKHIADSMKEDIQYSGTFSLHGN 651 G + K GR+ H I H H+AD + ED++Y GT ++ N Sbjct: 42 GKCDAKQMFTVFGRVAHFRNWIDH-HMADQVYEDVEYKGTMFVNTN 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,923,688 Number of Sequences: 59808 Number of extensions: 437137 Number of successful extensions: 1004 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1003 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -