BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0398 (738 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025727-1|AAG23391.3| 429|Caenorhabditis elegans Hypothetical ... 32 0.37 Z73969-8|CAA98239.1| 351|Caenorhabditis elegans Hypothetical pr... 31 1.1 AL132862-15|CAB60549.1| 703|Caenorhabditis elegans Hypothetical... 28 7.9 >AC025727-1|AAG23391.3| 429|Caenorhabditis elegans Hypothetical protein Y73E7A.3 protein. Length = 429 Score = 32.3 bits (70), Expect = 0.37 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = -3 Query: 451 LSILSIFGFKMWLPYTLIIVYGQSTDEVDHDLVVLTAFVYSNSVLSFGYFV 299 +S ++F F M++ Y+L+ V Q T + +L LTA YS L FG F+ Sbjct: 283 VSYFALFAFSMFIFYSLVTVVLQKTSALMFNLSTLTADFYS---LLFGIFM 330 >Z73969-8|CAA98239.1| 351|Caenorhabditis elegans Hypothetical protein C12D8.12 protein. Length = 351 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/65 (26%), Positives = 32/65 (49%) Frame = -3 Query: 574 DDVIDHQLISSIYPRNLQNLKLPPLCSLTVW*SICVIVIFHLSILSIFGFKMWLPYTLII 395 DDV +I+ YP + K P + + + ++ L ++ IFGFK + T ++ Sbjct: 172 DDVT--YIIADFYPMHENGQKFPSIGAFISGFNFLLMTTVSLFVIFIFGFKCYYEMTRVV 229 Query: 394 VYGQS 380 V G++ Sbjct: 230 VPGRN 234 >AL132862-15|CAB60549.1| 703|Caenorhabditis elegans Hypothetical protein Y73F8A.21 protein. Length = 703 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +1 Query: 592 IADSMKEDIQYSGTFSLHGNIPI 660 +A++M E++Q++ TFS G IP+ Sbjct: 401 LANAMSENLQFAQTFSNQGEIPL 423 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,602,677 Number of Sequences: 27780 Number of extensions: 342646 Number of successful extensions: 807 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1735436670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -