BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0398 (738 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 28 5.6 At2g39805.1 68415.m04889 integral membrane Yip1 family protein c... 28 5.6 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = -1 Query: 378 QTKSTMISLCSQHLFILTAYCRSDISFKSESATLACIVFGDKLKA*KQSRDTSCRR 211 QT ++S+ + ++ A R + F S + AC+ +GD LK + C R Sbjct: 443 QTNPEVVSVLNNVKMVVRARTRGNELFSSGRFSEACVAYGDGLKQDDSNSVLYCNR 498 >At2g39805.1 68415.m04889 integral membrane Yip1 family protein contains Pfam domain, PF04893: Yip1 domain Length = 275 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = -3 Query: 601 YQRYAYDISDDVIDHQLISSIYPRN---LQNLKLPPLCSLTVW*SICVIVIFHLSIL 440 Y +Y +D+ DV+ ++L+SS+YP + + P VW IC ++F L+ L Sbjct: 84 YTQY-FDVDTDVVLNRLMSSLYPTSGDFFNKIDANPDLYGLVW--ICTTLVFVLASL 137 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,325,645 Number of Sequences: 28952 Number of extensions: 309294 Number of successful extensions: 710 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -