BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0393 (845 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 25 3.8 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 24 5.1 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 24.6 bits (51), Expect = 3.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 674 DEEPSVSVLDNVIPPSNLS 618 DE+ + VL N+I PS LS Sbjct: 337 DEQTGIDVLGNIIEPSALS 355 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 24.2 bits (50), Expect = 5.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 315 RDFRL*ISKCS*LKMIAIPRYCGSCYSNEH 226 R + + SKC L+++ R C CY H Sbjct: 193 RQYTVGFSKCCRLRLLERRRQCYRCYEYGH 222 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 897,850 Number of Sequences: 2352 Number of extensions: 18610 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89718867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -