BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0389 (774 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2130| Best HMM Match : fn2 (HMM E-Value=2.7e-15) 28 7.3 SB_23399| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_2130| Best HMM Match : fn2 (HMM E-Value=2.7e-15) Length = 430 Score = 28.3 bits (60), Expect = 7.3 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 171 FGFKTKAC*RFCTSDALFPTSLGT*SSLNE 260 FG + ++C +F T L P+SL T SSL + Sbjct: 353 FGTRCRSCDKFVTERRLVPSSLTTKSSLGD 382 >SB_23399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 827 Score = 27.9 bits (59), Expect = 9.6 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 191 LLKILYQRRIVSNQSWHLKLPQRAGGTRRSCVTSQL 298 + KILYQ ++ + L L QRAG T V S+L Sbjct: 722 MCKILYQNAELNRKLEELSLKQRAGSTDEEEVVSRL 757 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,781,797 Number of Sequences: 59808 Number of extensions: 385481 Number of successful extensions: 820 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -