BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0389 (774 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 24 4.5 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 6.0 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.9 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 24.2 bits (50), Expect = 4.5 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = -3 Query: 319 SSTDSISKL*RHTTTSRATCSLRELQVPRLVGNNASLVQNLQQAFVLKPKTNLHIHWS 146 ++T + K+ + +S ++ ++ + L NN+S + V+ + NLH H S Sbjct: 860 TATGGMLKMPPSSNSSPSSYPSPDVVISGLASNNSSSSNLVAAGMVINDENNLHYHRS 917 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 6.0 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -2 Query: 128 RRRLQTTATNTARPKAIIADRHPSTNSESGARSVTRSPLI 9 R R TAT T + + A RH E RS +S LI Sbjct: 1794 RHRSLVTATKTRKKQQTEAIRHAMLQQEDKQRSERQSFLI 1833 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 504 SAFTIYNPNRLVNS 463 SAF + NPN+L+N+ Sbjct: 2844 SAFIVTNPNQLINT 2857 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 707,964 Number of Sequences: 2352 Number of extensions: 13169 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -